Recombinant Vibrio harveyi Probable intracellular septation protein A (VIBHAR_02768)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
yciB; VIBHAR_02768; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
VIBHAR_02768
Target Protein Sequence
MKQILDFIPLIVFFALYKMYDIYVATGALIVATAIQIVLTFALYKKVEKMQLITFAMVAI FGGMTIFLHDENFIKWKVTIVYAIFAIGLAVSHAMGKSAIKGMLGKEITLPDAIWTKINW AWVAFFSFCAGLNVYVAFELPLDVWVNFKVFGLLIATFAYMIATGFYIYKHMPKEQKEQK EKSSDVSLDD
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Vibrio harveyi and why is it significant for studying septation proteins?

Vibrio harveyi is a gram-negative bacterium belonging to the family Vibrionaceae of class Gammaproteobacteria. It is a well-recognized and serious bacterial pathogen affecting marine fish and invertebrates, particularly in aquaculture settings. The significance of studying V. harveyi stems from its role as the etiological agent of several diseases, including luminous vibriosis in shrimp where affected animals glow in the dark .

The study of intracellular septation proteins in V. harveyi is particularly important as these proteins are often involved in cell division processes and may contribute to bacterial survival, pathogenicity, and resistance mechanisms. Understanding these conserved proteins provides insights into fundamental bacterial processes and potential targets for controlling infections in aquaculture.

What are the genetic characteristics of the YgjD protein in V. harveyi?

Based on current research, the YgjD gene in V. harveyi strain SF-1 consists of 1,017 base pairs encoding a 338 amino acid polypeptide. The nucleotide sequence of this gene shows 95% similarity with that of V. harveyi FDAARGOS 107 . Comparative genomic analysis also reveals significant homology with YgjD genes from other bacterial species, with sequence similarities of 68%, 67%, and 50% to those of Salmonella enterica, Escherichia coli, and Bacillus cereus, respectively .

The high degree of conservation across diverse bacterial species suggests that YgjD serves an essential function in bacterial physiology, making it an important target for fundamental research on bacterial cell processes.

How can researchers distinguish between basic and advanced aspects of VIBHAR_02768 research?

Basic research on VIBHAR_02768/YgjD should focus on:

  • Gene sequence and protein structural analysis

  • Expression patterns under standard growth conditions

  • Basic proteolytic activity characterization

  • Phylogenetic relationships with homologous proteins

Advanced research should address:

  • Site-directed mutagenesis of conserved domains

  • Protein-protein interaction networks

  • Effects on cellular processes such as growth and VBNC state

  • Potential roles in pathogenicity mechanisms

  • Structural determination through crystallography or cryo-EM

  • Systems biology approaches to understand integrated cellular functions

What expression systems yield optimal results for recombinant V. harveyi YgjD protein?

For recombinant expression of V. harveyi YgjD, the E. coli BL21(DE3) expression system has proven effective. A recommended methodology includes:

  • Cloning the full-length YgjD gene into an expression vector such as pET-28a(+)

  • Transforming the recombinant plasmid into E. coli BL21(DE3) cells

  • Inducing protein expression under optimized conditions

This approach has successfully yielded functional YgjD protein with demonstrable enzymatic activity . When employing this expression system, researchers should pay particular attention to optimization of induction conditions to maximize protein yield while maintaining proper folding.

What purification strategies ensure highest purity and preserved activity?

The most effective purification strategy for recombinant YgjD protein involves:

  • Affinity chromatography using Ni²⁺ columns (for His-tagged recombinant protein)

  • Buffer optimization to maintain protein stability

  • Quality control via SDS-PAGE analysis

Using this methodology, researchers have successfully purified YgjD to homogeneity, as evidenced by a distinct 37 kDa band on SDS-PAGE . The purified protein maintained significant enzymatic activity, suggesting that the purification process preserved the native conformation of the protein's catalytic domains.

How can researchers verify the functional integrity of purified recombinant YgjD?

Verification of functional integrity should include:

  • Enzymatic activity assays using substrates such as:

    • N-Acetyl-L-tyrosine ethyl ester monohydrate (ATEE)

    • N-Benzoyl-L-tyrosine ethyl ester (BTEE)

    • N-Benzoyl-DL-arginine-4-nitroanilide hydrochloride (BAPNA)

  • Assessment of effects on bacterial growth:

    • Addition of purified protein to V. harveyi cultures

    • Monitoring growth curves compared to controls

    • Quantification of growth enhancement (e.g., 177.01% increase at 20 μg/mL concentration)

  • Structural analysis:

    • Circular dichroism to confirm secondary structure

    • Limited proteolysis to verify folding integrity

What enzymatic activities are associated with YgjD and how can they be quantified?

YgjD demonstrates significant protease activity that can be quantified using various substrates:

SubstrateActivity (units/mg)
ATEE59,000
BTEE53,700
BAPNA8,100

These values represent the specific enzymatic activity of the purified recombinant protein . The significant difference in activity between substrates suggests substrate specificity that may be relevant to the protein's biological function.

What is the significance of the conserved "HXEXH" motif in YgjD?

The "HXEXH" motif represents a highly conserved sequence critical for the proteolytic activity of YgjD. Site-directed mutagenesis studies revealed:

  • Single amino acid substitutions (H111A, E113A, or H115A) significantly reduced enzymatic activity with all tested substrates

  • The H111A mutation nearly eliminated activity with BAPNA as substrate

  • The E113A mutation inactivated the enzyme with BTEE substrate

  • The H115A mutation nearly inactivated the enzyme with both ATEE and BTEE substrates

  • The double mutation (H111A+H115A) completely abolished all enzymatic activity

These findings demonstrate that the two histidine residues (H111 and H115) are absolutely essential for catalytic function, while the glutamic acid (E113) also plays a significant role in substrate specificity.

How do metal ions and inhibitors affect YgjD activity?

Research has demonstrated that YgjD activity is modulated by various ions and inhibitors:

  • Activity enhancement:

    • Zn²⁺ increases protease activity

  • Activity inhibition:

    • Cu²⁺, Ca²⁺, Mn²⁺, and Co²⁺ partially inhibit protease activity

    • Chelating agents (EDTA, EGTA) reduce activity

    • Serine protease inhibitor (PMSF) partially inhibits activity

These effects suggest that YgjD may be a metalloprotease with Zn²⁺ as a potential cofactor, while the partial inhibition by PMSF indicates possible mechanistic complexity beyond classic metalloproteases.

What is the relationship between YgjD and V. harveyi growth?

Experimental evidence indicates that purified recombinant YgjD positively influences V. harveyi growth in a concentration-dependent manner:

  • At 20 μg/mL concentration, YgjD increased growth rate by 177.01% compared to control groups with denatured protein

  • At 10 μg/mL concentration, growth increased by 120.52% compared to normal growth conditions

This growth-promoting effect suggests that YgjD plays an important role in cellular physiology, potentially through its proteolytic activity that may be involved in processing proteins essential for growth or division.

How does YgjD interact with the viable but nonculturable (VBNC) state in V. harveyi?

The VBNC state represents a significant survival strategy for V. harveyi under stress conditions. Research has shown that V. harveyi can enter this state, which may be an important factor in vibriosis outbreaks in aquaculture . Specifically regarding YgjD:

  • Experiments with VBNC cells induced by H₂O₂ (50 mM) treatment demonstrated that purified recombinant YgjD did not show obvious promoting effects on resuscitation of VBNC cells

  • This suggests that while YgjD enhances normal cell growth, its role may be limited or different in the context of stress response and VBNC state recovery

This distinction between effects on normal growth versus VBNC recovery points to the complexity of bacterial physiological responses and the specific contexts in which YgjD functions.

Could YgjD be involved in V. harveyi pathogenicity mechanisms?

V. harveyi employs multiple pathogenicity mechanisms that differ between fish and invertebrate hosts:

  • In fish:

    • Pathogenicity involves extracellular hemolysins (encoded by duplicate hemolysin genes)

    • These hemolysins function as phospholipase B and can induce apoptosis via the caspase activation pathway

  • In shrimp:

    • Pathogenicity involves endotoxin lipopolysaccharide and extracellular proteases

    • Interactions with bacteriophages also contribute to virulence

While the direct involvement of YgjD in these pathogenicity mechanisms is not explicitly established in the available research, its protease activity suggests potential roles in protein processing that could contribute to virulence. Further research would be needed to determine if YgjD interacts with known virulence factors or contributes to pathogenicity independently.

What techniques are most effective for studying protein-protein interactions of YgjD?

To investigate protein-protein interactions involving YgjD, researchers should consider:

  • Pull-down assays using His-tagged recombinant YgjD

  • Bacterial two-hybrid systems

  • Co-immunoprecipitation with antibodies against YgjD

  • Cross-linking studies followed by mass spectrometry

  • Proximity-based labeling techniques (BioID, APEX)

These approaches could identify interaction partners that might reveal functional networks involving YgjD in cellular processes such as septation, growth regulation, or stress response.

How can researchers investigate the in vivo function of YgjD in V. harveyi?

In vivo functional analysis of YgjD should employ:

  • Gene knockout or knockdown strategies:

    • CRISPR-Cas9 systems adapted for V. harveyi

    • Conditional expression systems

    • Antisense RNA approaches

  • Complementation studies:

    • Reintroduction of wild-type and mutant variants

    • Heterologous expression in model organisms

  • Localization studies:

    • Fluorescent protein fusions

    • Immunolocalization using specific antibodies

  • Transcriptomic and proteomic analysis:

    • RNA-seq of wild-type versus YgjD-deficient strains

    • Proteome changes in response to YgjD modulation

What are the emerging research directions for understanding YgjD in bacterial physiology?

Future research on YgjD should focus on:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine three-dimensional structure

    • Molecular dynamics simulations to understand conformational changes

  • Systems biology integration:

    • Network analysis of YgjD in cellular pathways

    • Metabolomic changes associated with YgjD activity

  • Comparative studies across Vibrio species:

    • Functional conservation and divergence

    • Host-specific adaptations

  • Potential applications:

    • Development of specific inhibitors as research tools

    • Evaluation as targets for controlling V. harveyi infections in aquaculture

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.