Recombinant Vibrio harveyi Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ubiB; VIBHAR_00564; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
ubiB
Target Protein Sequence
MTPAEIKRLYQIIKVQLEYGLDELLPDHQLTKAPLLMRKSLFWIKNKHPEKPLGERLRLA LQELGPVWIKFGQMMSTRRDLFPPHIADPLALLQDQVAPFDGQLAKEQMELALGGPLQNW FTEFDIKPLASASIAQVHTARLKDTNQEVVLKVIRPDIRPVIDSDLKLMHRMASIVAGAM PEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFEGSEELYVPEVFPDFSNETVM VSERIYGIQVSDIEGLEANGTNMKLLAERGVSVFFTQVFRDSFFHADMHPGNVFVKPEHP ENPMWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAELHVDSGWVPADTNVDEFEF AIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWETAKPFLEEWMMNQVGPQALVNAIKDRAPFWAEKLPELPELLYDSLRQGKAMNQR MDQLYQGYRHSKRQQATGKFLFGVGATLVVCSAILVDNAYEQLSIASGIAGVTFWLLSWR AYRR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of UbiB in Vibrio harveyi?

UbiB in Vibrio harveyi is characterized as a probable protein kinase belonging to the ABC1 family, UbiB subfamily. Based on homology with better-characterized bacterial systems, it is predicted to be a multi-pass membrane protein localized to the cell inner membrane . The protein contains conserved domains typical of the ABC1 family of atypical kinases, which are involved in various regulatory processes including ubiquinone biosynthesis. While the exact three-dimensional structure has not been fully determined, it likely shares structural similarities with other ABC1 family members that typically feature kinase-like domains with ATP-binding motifs.

What is the established function of UbiB in bacterial ubiquinone biosynthesis?

UbiB plays a critical but not fully elucidated role in ubiquinone biosynthesis. It is required, likely indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, which represents a crucial step in the ubiquinone biosynthesis pathway . Unlike other enzymes in this pathway with well-defined catalytic activities, UbiB's precise biochemical mechanism remains somewhat enigmatic. In Escherichia coli, UbiB is involved in both aerobic and anaerobic ubiquinone biosynthesis pathways, suggesting a fundamental role regardless of oxygen conditions . This versatility is significant because it indicates UbiB's potential importance in helping bacteria adapt to various environmental oxygen levels.

What expression systems are most suitable for recombinant Vibrio harveyi UbiB production?

For successful expression of recombinant V. harveyi UbiB, specialized expression systems designed for membrane proteins are recommended. Given UbiB's characteristics as a membrane protein, the following methodological approach is advised:

  • Expression host selection:

    • E. coli strains C41(DE3) or C43(DE3), which are engineered specifically for membrane protein expression

    • Alternative hosts like Vibrio species may provide more native-like membrane environments

  • Vector considerations:

    • Vectors with tunable promoters (T7 or arabinose-inducible)

    • Inclusion of appropriate fusion tags (His6, FLAG) for purification

    • Signal sequences that facilitate proper membrane insertion

  • Expression conditions:

    • Lower post-induction temperatures (16-20°C) to slow protein synthesis and promote proper folding

    • Supplementation with glycerol (5-10%) to stabilize membrane proteins

    • Controlled induction with reduced inducer concentrations

These strategies aim to balance protein yield with proper folding and membrane insertion, which are critical challenges when working with membrane proteins like UbiB.

What purification protocol optimizes retention of UbiB native conformation?

Purification of UbiB requires specialized techniques to maintain the protein's native conformation within its membrane environment:

Purification StageRecommended MethodCritical Parameters
Cell disruptionSonication or French pressBuffer with protease inhibitors, maintaining 4°C
Membrane isolationDifferential ultracentrifugation100,000-150,000 × g, 1-2 hours
Membrane protein extractionDetergent solubilizationDDM (0.5-1%), OG (0.5-2%), or digitonin (0.5-1%)
Initial purificationIMAC (His-tag) or affinity chromatographyInclusion of detergent above CMC in all buffers
Secondary purificationSize exclusion chromatographyRemoval of aggregates, detergent exchange
Functional reconstitutionProteoliposomes or nanodiscsLipid composition similar to V. harveyi membranes

Throughout all purification steps, maintaining detergent concentration above the critical micelle concentration is essential to prevent protein aggregation. For functional studies, reconstitution into lipid bilayers provides a more native-like environment than detergent micelles .

How can the enzymatic activity of purified UbiB be reliably assessed in vitro?

Assessing UbiB enzymatic activity is challenging due to its unclear biochemical function. A multi-faceted approach is recommended:

  • Kinase activity assays:

    • ATP binding measurements using isothermal titration calorimetry

    • ATP hydrolysis detection with coupled enzyme assays

    • Identification of potential protein or small molecule substrates for phosphorylation

  • Ubiquinone biosynthesis assays:

    • In vitro reconstitution of the hydroxylation step (2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol)

    • HPLC or LC-MS analysis of substrate conversion

    • Complementation with other pathway components to assess UbiB's contribution

  • Protein-protein interaction studies:

    • Pull-down assays to identify binding partners

    • Surface plasmon resonance to quantify interaction kinetics

    • Cross-linking mass spectrometry to map interaction interfaces

The assessment should include proper controls, including catalytically inactive mutants and related proteins from the UbiB family, to confirm the specificity of observed activities.

What methods can differentiate between UbiB's role in aerobic versus anaerobic ubiquinone biosynthesis?

Based on research in E. coli, UbiB participates in both aerobic and anaerobic ubiquinone biosynthesis pathways . To distinguish its role under different oxygen conditions in V. harveyi, the following methodological approaches are recommended:

  • Comparative expression analysis:

    • qRT-PCR measuring ubiB expression under aerobic, microaerobic, and anaerobic conditions

    • Western blotting to quantify UbiB protein levels across oxygen conditions

    • Reporter gene fusions to monitor promoter activity in real-time during oxygen transitions

  • Functional analysis under controlled oxygen conditions:

    • UbiB knockout complementation studies under varying oxygen levels

    • Metabolic labeling with isotope tracers to track ubiquinone synthesis

    • Oxygen consumption measurements to correlate UbiB function with respiratory activity

  • Protein complex analysis:

    • Co-immunoprecipitation under different oxygen conditions to identify oxygen-dependent interaction partners

    • Blue native PAGE to visualize potential changes in protein complex formation

    • Comparative crosslinking mass spectrometry across oxygen conditions

Oxygen ConditionExpected UbiB Interaction PartnersAnalytical Method
AerobicUbiA, UbiG, UbiH, UbiE, UbiFCo-IP, BN-PAGE
AnaerobicUbiA, UbiG, UbiE, UbiT, UbiU, UbiVCo-IP, BN-PAGE
TransitionalMixture of both aerobic and anaerobic partnersTime-course analysis

This comparative approach would help delineate how UbiB functions within potentially distinct ubiquinone biosynthesis complexes under different oxygen regimes .

How does temperature stress affect UbiB function and ubiquinone biosynthesis in Vibrio harveyi?

Temperature stress significantly impacts V. harveyi physiology and potentially affects UbiB function and ubiquinone biosynthesis. Research has shown that at elevated temperatures (30°C), V. harveyi undergoes substantial physiological changes, including altered gene expression patterns that affect metabolic pathways . For UbiB specifically, temperature stress likely influences:

  • Protein stability and activity:

    • Elevated temperatures may affect UbiB folding and membrane integration

    • Kinetic parameters of any enzymatic activity may change with temperature

    • Potential temperature-sensitive protein-protein interactions within the ubiquinone biosynthesis complex

  • Expression regulation:

    • Temperature stress response may alter ubiB transcription and translation

    • Post-translational modifications might be temperature-dependent

    • Shifts in membrane fluidity at different temperatures could affect UbiB function

Research approaches should include comparative analysis of ubiquinone production at different temperatures in wild-type versus ubiB mutant strains, as well as temperature-dependent protein stability and activity assays .

What is the relationship between UbiB function, ubiquinone biosynthesis, and Vibrio harveyi virulence?

While direct evidence on UbiB's role in V. harveyi virulence is limited in the provided search results, connections can be drawn based on the fundamental importance of ubiquinone in bacterial metabolism and pathogenicity:

  • Energy production for virulence mechanisms:

    • Ubiquinone is essential for aerobic and anaerobic respiration, providing energy for virulence factor production and secretion

    • V. harveyi adaptation to elevated temperatures (which occurs during infection) shows increased expression of virulence genes despite physiological stress

    • Disruption of ubiquinone biosynthesis would likely impair energy-dependent virulence mechanisms

  • Adaptation to host environments:

    • Similar to E. coli, V. harveyi likely requires UbiB for ubiquinone biosynthesis under varying oxygen conditions encountered during infection

    • The ability to synthesize ubiquinone anaerobically would be advantageous when colonizing oxygen-limited host tissues

  • Stress response integration:

    • Virulence gene expression in V. harveyi increases under certain stress conditions

    • UbiB may contribute to coordination between metabolic adaptation and virulence regulation during host colonization

Research approaches would include virulence phenotyping of ubiB mutants in relevant infection models, assessment of virulence factor production, and evaluation of host colonization efficiency .

How does UbiB from Vibrio harveyi compare to homologous proteins in other bacterial species?

Comparative analysis of UbiB across bacterial species reveals important evolutionary and functional insights:

SpeciesUbiB CharacteristicsFunctional ContextNoteworthy Differences
V. harveyiProbable protein kinase, membrane-boundMarine pathogen with temperature adaptabilityLikely specialized for marine environment
V. choleraeMulti-pass membrane proteinHuman pathogen with environmental persistenceSerotype O1 variant described as recombinant protein
E. coliAtypical kinase, precise function elusiveFunctions in both aerobic and anaerobic pathwaysBetter characterized in literature, works with UbiT, UbiU, UbiV under anaerobiosis

Key structural similarities likely include:

  • Conserved ABC1 kinase domains

  • Similar membrane topology

  • Conservation of critical residues involved in ATP binding

Functional conservation analysis suggests UbiB's role in ubiquinone biosynthesis is maintained across these species, but with potential adaptations to different ecological niches and metabolic requirements .

What mechanisms regulate ubiB expression in Vibrio harveyi compared to other bacterial systems?

Regulation of ubiB expression appears to be sophisticated and responsive to environmental conditions across bacterial species. Based on research in E. coli, several regulatory mechanisms can be inferred for V. harveyi:

  • Oxygen-dependent regulation:

    • In E. coli, the O₂-sensing Fnr transcriptional regulator controls expression of anaerobic ubiquinone biosynthesis genes

    • V. harveyi likely possesses similar oxygen-responsive regulation but tuned to its marine lifestyle

  • Temperature-dependent regulation:

    • V. harveyi shows distinct gene expression patterns at elevated temperatures (30°C)

    • Temperature-responsive regulators may influence ubiB expression to maintain respiratory function under thermal stress

  • Metabolic integration:

    • Coordination with central metabolism and respiratory chain components

    • Potential feedback regulation based on ubiquinone levels or precursor availability

The regulatory architecture likely differs between species based on their specific environmental adaptations, with V. harveyi's regulation potentially optimized for fluctuating marine conditions including temperature, oxygen, and salinity variations .

How can UbiB be utilized as a target for developing novel antimicrobials against Vibrio species?

UbiB represents a potential antimicrobial target due to its essential role in ubiquinone biosynthesis, which is critical for bacterial respiration and energy production. Strategic approaches for targeting UbiB include:

  • Structure-based inhibitor design:

    • In silico modeling of UbiB's ATP-binding pocket to design competitive inhibitors

    • Fragment-based screening to identify molecules that disrupt UbiB function

    • Allosteric inhibitors targeting unique structural features of bacterial UbiB proteins

  • Pathway-focused approaches:

    • Designing mimetics of ubiquinone precursors that block the UbiB-mediated step

    • Targeting protein-protein interactions between UbiB and other components of the ubiquinone biosynthesis complex

    • Disrupting the membrane localization of UbiB

  • Functional screening platforms:

    • High-throughput assays measuring ubiquinone production in the presence of candidate inhibitors

    • Growth inhibition assays under conditions requiring functional UbiB

    • Thermal shift assays to identify compounds that bind and destabilize UbiB

This approach is particularly promising because ubiquinone biosynthesis differs significantly between bacteria and humans, potentially allowing for selective targeting of bacterial UbiB without affecting host metabolism .

What is the potential role of UbiB in Vibrio harveyi adaptation to marine environments with fluctuating oxygen levels?

Marine environments present dynamic oxygen gradients that require metabolic flexibility. UbiB likely plays a crucial role in V. harveyi's adaptation to these conditions:

  • Oxygen transition management:

    • Similar to E. coli, V. harveyi UbiB may function in both aerobic and anaerobic ubiquinone biosynthesis

    • This dual functionality would allow V. harveyi to maintain respiratory capabilities across varying oxygen conditions in marine environments

    • UbiB might contribute to the rapid metabolic shifts required when moving between oxygen-rich surface waters and oxygen-limited microenvironments

  • Integration with stress response mechanisms:

    • Marine bacteria face multiple simultaneous stressors (temperature, salinity, nutrient limitation)

    • UbiB's role in maintaining energy production during stress conditions would be critical for survival

    • Research on V. harveyi adaptation to elevated temperatures (30°C) shows significant physiological adjustments that likely involve respiratory adjustments

  • Specific adaptations in the V. harveyi UbiB system:

    • Potential specialization of UbiB function for the marine environment

    • Possible co-regulation with systems managing other marine stressors

    • Coordination with V. harveyi's bioluminescence, which requires energy from respiratory metabolism

Understanding this role would provide insights into how V. harveyi maintains energy homeostasis across the diverse microenvironments it encounters in marine ecosystems .

How can CRISPR-Cas9 genetic manipulation be optimized for studying ubiB function in Vibrio harveyi?

CRISPR-Cas9 technology offers powerful approaches for investigating ubiB function in V. harveyi, but requires optimization for this specific bacterial system:

  • Delivery system optimization:

    • Conjugation-based delivery methods may be enhanced when V. harveyi is subjected to mild stress conditions, as research shows stress exposure can trigger improved conjugation efficiency

    • Electroporation protocols specifically tailored to V. harveyi's cell wall characteristics

    • Potential use of phage-based delivery systems adapted for Vibrio species

  • Guide RNA design considerations:

    • Accounting for V. harveyi genome's GC content and potential off-target sites

    • Targeting conserved regions of ubiB to ensure complete knockout

    • Designing guides for precise point mutations to study specific functional domains

  • Phenotypic analysis strategies:

    • High-throughput growth assays under various oxygen conditions

    • Metabolomic profiling to assess changes in ubiquinone and related metabolites

    • Complementation with wild-type and mutant versions to confirm phenotype specificity

For precise genetic manipulation, researchers should consider that V. harveyi shows enhanced capacity to receive plasmids when treated with specific stress conditions, such as brief exposure to 0.04–0.05 M NaOH for 5–20 minutes or 0.012-0.024 M HCl for 5–30 minutes .

What experimental approaches would best elucidate the interaction between UbiB and the UbiUVT complex in ubiquinone biosynthesis?

Based on research in E. coli, UbiB functions alongside the UbiUVT complex in anaerobic ubiquinone biosynthesis . Investigating these interactions in V. harveyi would require sophisticated experimental approaches:

  • Protein interaction mapping:

    • Bacterial two-hybrid or split-protein complementation assays to detect direct interactions

    • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Crosslinking mass spectrometry to map interaction interfaces at amino acid resolution

  • Structural biology approaches:

    • Cryo-electron microscopy of the entire ubiquinone biosynthesis complex

    • X-ray crystallography of co-purified components

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in protein-protein interactions

  • Functional reconstitution experiments:

    • In vitro reconstitution of the complete biosynthetic pathway with purified components

    • Activity assays with systematic omission of individual components

    • Mutational analysis of predicted interaction interfaces

This multi-faceted approach would help determine whether V. harveyi utilizes a similar UbiUVT system for anaerobic ubiquinone biosynthesis as observed in E. coli, and how UbiB integrates with this complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.