Recombinant Vibrio harveyi Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lgt; VIBHAR_00970; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
lgt
Target Protein Sequence
MSQGYLEFPNIDPVLVSIGPVSVRWYGLMYLVGFMFALWLANRRADKPGSGWTREQVSDL LFAGFLGVVIGGRVGYVIFYNFDLFLADPLYLFKVWTGGMSFHGGLLGVITAMFWYAHKN GRTFFGVADFVAPLVPFGLGMGRMGNFMNSELWGRVTDVPWAIIFPNGGPLPRHPSQLYE MFLEGIVLFFILNWFIKKPRPLGAVSGLFLAGYGTFRFLVEFVREPDAQLGLFGGYISMG QILSSPMIILGILMMVWAYKRGLYQDKVQAETK
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Lgt in Vibrio harveyi?

Lgt in V. harveyi, like in other Gram-negative bacteria, functions as the committing enzyme in lipoprotein modification. It catalyzes the attachment of a negatively charged diacylglycerol moiety, particularly phosphatidylglycerol, to the thiol group of the conserved +1 position cysteine residue in preprolipoproteins via a thioester bond . This modification represents the first of two or three post-translational steps in bacterial lipoprotein biogenesis. The reaction occurs after the preprolipoprotein crosses the cytoplasmic membrane, typically via the general secretory (Sec) pathway, although some preprolipoproteins may cross through the twin-arginine translocation (TAT) pathway in a folded conformation . Recognition of the signal peptide alone is sufficient for Lgt to catalyze this reaction.

How does the structure of Lgt relate to its function?

Based on in silico predictions and experimental evidence from E. coli Lgt (which shares structural similarities with V. harveyi Lgt), the enzyme is a multipass integral membrane protein containing five transmembrane (TM) helices with its C-terminus exposed to the cytoplasm . Several critical residues have been identified that directly impact enzyme activity:

  • His103 within the predicted TM helix 3 is essential for activity

  • Tyr235 in the predicted TM helix 4 affects activity

  • His196 in a predicted large cytoplasmic loop also influences enzyme function

This structural arrangement suggests that the first step of lipoprotein modification likely occurs within the cytoplasmic membrane or at its interface with the cytoplasm. Interestingly, recombinant Lgt can retain full specific activity in an aqueous environment, which has implications for expression and purification strategies .

How can recombinant V. harveyi Lgt activity be measured in vitro?

The enzymatic activity of recombinant V. harveyi Lgt can be assessed using an assay that measures the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . The peptide substrate typically used is derived from bacterial lipoproteins, such as Pal (Pal-IAAC, where C is the conserved cysteine modified by Lgt).

The standard assay procedure involves:

  • Incubating purified recombinant Lgt with phosphatidylglycerol and the peptide substrate

  • Detecting released glycerol phosphate through a coupled enzymatic reaction

  • Quantifying the reaction product using spectrophotometric or luminescence-based methods

When phosphatidylglycerol contains a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) may be released, with G3P detection commonly achieved through a coupled luciferase reaction . Negative controls typically include mutant peptide substrates where the conserved cysteine is replaced with alanine (e.g., Pal-IAA).

What are the optimal conditions for expressing recombinant V. harveyi Lgt?

Based on protocols developed for related bacterial Lgt proteins, the following conditions are recommended for recombinant V. harveyi Lgt expression:

Expression System: E. coli BL21(DE3) or similar expression strains are preferred hosts, as they have been successfully used for other bacterial membrane proteins.

Growth Conditions:

  • Medium: LB or 2xYT supplemented with appropriate antibiotics

  • Temperature: 25-30°C after induction (lower temperatures reduce inclusion body formation)

  • Induction: 0.1-0.5 mM IPTG when culture reaches OD600 of 0.6-0.8

  • Post-induction growth: 4-6 hours at reduced temperature

Membrane Protein Considerations:

  • Addition of 0.5-1% glycerol to culture medium may improve protein folding

  • E. coli C43(DE3) strain may be preferred for toxic membrane proteins

  • Fusion tags (such as MBP or SUMO) might enhance solubility

The ability to efficiently transform E. coli with expression constructs would benefit from methods similar to those that have been established for introducing shuttle plasmids into V. harveyi, including potential stress treatments that enhance conjugation efficiency .

How does environmental stress affect the expression and activity of recombinant V. harveyi Lgt?

Environmental stress factors can significantly impact both the expression of recombinant proteins in host organisms and potentially the activity of Lgt enzyme. Based on studies of V. harveyi stress responses, the following parameters should be considered when working with recombinant Lgt:

Temperature Stress:

  • Heat shock (37-46°C for 5-60 minutes) has been shown to alter membrane properties in V. harveyi

  • Optimal recombinant Lgt activity may be maintained in the range of 28-37°C

  • Temperatures above 40°C for extended periods may denature the protein or alter membrane association

Chemical Stress:

  • Ethanol (4-16%), SDS (0.14-0.56 mM), NaOH (0.04-0.05 M), and HCl (0.012-0.024 M) exposures influence membrane permeability in V. harveyi

  • These same stressors may affect recombinant Lgt structure and function

  • Short exposures to mild stressors may increase enzyme activity by altering membrane fluidity

Salt Concentration:

  • NaCl concentrations between 0.5-4.0% influence V. harveyi physiology

  • Optimal Lgt activity likely requires physiological salt concentrations (2-3% NaCl)

  • Higher salt concentrations may stabilize membrane-associated Lgt but could reduce catalytic efficiency

These stress factors should be systematically evaluated during recombinant V. harveyi Lgt purification and activity assays to determine optimal conditions for enzyme function.

What are the methodological challenges in establishing a homologous recombination system for V. harveyi lgt gene modification?

Establishing an efficient homologous recombination system for V. harveyi lgt gene modification presents several methodological challenges that researchers must address:

Conjugation Efficiency:

  • Wild-type V. harveyi typically shows low fertility and inefficient conjugation with donor bacteria (e.g., E. coli)

  • Specific stress treatments can enhance conjugation efficiency:

    • Heat shock (40°C for 60 minutes) yielding up to 5.3 × 10³ transconjugants

    • Ethanol treatment (16% for 10 minutes) producing up to 2.5 × 10⁵ transconjugants

    • NaOH treatment (0.05 M for 10 minutes) leading to 2.3 × 10³ transconjugants

    • SDS treatment (0.42 mM for 5 minutes) resulting in 4.5 × 10² transconjugants

    • HCl treatment (0.024 M for 5 minutes) generating 1.8 × 10² transconjugants

Vector Selection:

  • Suicide plasmids used for homologous recombination must contain:

    • Origin of replication incompatible with V. harveyi

    • Antibiotic resistance marker functional in V. harveyi

    • Homology arms flanking the lgt gene region (typically 500-1000 bp each)

Screening Methods:

  • PCR verification of transconjugants using specific primers (e.g., similar to pMMB207-F and pMMB207-R with expected product size)

  • Phenotypic screening for altered membrane integrity if Lgt function is disrupted

  • Functional complementation assays to verify gene knockout specificity

Recent advances have led to breakthrough improvements in conjugation efficiency for V. harveyi, enabling establishment of homologous recombination gene knockout technology based on stress stimulation, which has greatly facilitated molecular mechanism research in this organism .

How does Lgt inhibition affect the quorum sensing regulatory network in V. harveyi?

The relationship between Lgt inhibition and quorum sensing (QS) in V. harveyi represents an important area of research with implications for bacterial pathogenesis. Current findings suggest:

Effects on QS Circuitry:

  • V. harveyi employs quorum sensing for cell-to-cell communication, controlling bioluminescence (through luxR) and virulence gene expression (including vhp and chiA)

  • Lgt inhibition disrupts lipoprotein processing, potentially affecting membrane-associated QS receptors

  • Altered membrane integrity following Lgt inhibition may disrupt autoinducer sensing and signal transduction

Virulence Factor Expression:

  • Quorum sensing activation in V. harveyi may not directly regulate expression of all virulence factors

  • Studies suggest that while QS may be activated, it doesn't necessarily regulate the expression of virulence factors like metalloprotease (vhp) and chitinase (chiA) under all conditions

  • Lgt inhibition's impact on virulence may involve both QS-dependent and QS-independent mechanisms

Interspecies Communication:

  • V. harveyi interacts with other marine organisms, including diatoms like Skeletonema marinoi

  • Lgt inhibition could potentially disrupt these cross-kingdom communication networks

  • The commensalism relationship observed between V. harveyi and S. marinoi might be affected by alterations in lipoprotein processing

Researchers investigating the intersection of Lgt function and quorum sensing should consider designing experiments that monitor QS-regulated gene expression following Lgt inhibition or depletion, using reporter systems linked to luxR-regulated promoters.

How do inhibitors of Lgt in E. coli compare to potential inhibitors of V. harveyi Lgt?

Comparing Lgt inhibitors across bacterial species provides valuable insights for developing targeted antimicrobial strategies. Based on current research:

E. coli Lgt Inhibitors:

  • Several potent inhibitors of E. coli Lgt have been identified (e.g., G9066, G2823, G2824) with IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively

  • These inhibitors were identified through Lgt binding screens and confirmed to inhibit enzymatic function in vitro

  • The inhibitory effects and resulting phenotypes are recapitulated in lgt inducible deletion strains

Structural Considerations for V. harveyi Lgt Inhibitors:

  • Lgt is a highly conserved enzyme across Gram-negative bacteria, suggesting that inhibitors effective against E. coli Lgt might also target V. harveyi Lgt

  • Potential binding sites include:

    • The phosphatidylglycerol binding site, which is likely conserved

    • The signal peptide recognition region

    • Catalytic sites involving conserved His103, Tyr235, and His196 residues

Resistance Mechanisms:

  • Unlike inhibitors of downstream steps in lipoprotein biosynthesis, resistance to Lgt inhibitors cannot be conferred by deleting the major outer membrane lipoprotein (lpp)

  • This suggests that Lgt inhibitors may be less susceptible to one common resistance mechanism

  • Mutations that disrupt inhibitor binding might compromise Lgt function, potentially resulting in cell death

Methodological Approach to Inhibitor Discovery:

  • Perform sequence alignment and structural modeling of V. harveyi Lgt based on available Lgt structures

  • Adapt the E. coli Lgt biochemical assay to V. harveyi Lgt

  • Screen known E. coli Lgt inhibitors against recombinant V. harveyi Lgt

  • Develop species-specific modifications to enhance inhibitor potency and selectivity

Developing V. harveyi-specific Lgt inhibitors could provide valuable tools for studying lipoprotein processing in this marine pathogen and potentially lead to new antimicrobial strategies.

What expression system is optimal for producing functional recombinant V. harveyi Lgt?

Producing functional recombinant V. harveyi Lgt requires careful consideration of expression systems to ensure proper folding and membrane integration of this multipass transmembrane protein. Based on experimental approaches for similar enzymes:

Bacterial Expression Systems:

Expression SystemAdvantagesLimitationsYield Expectations
E. coli BL21(DE3)High expression, established protocolsMay form inclusion bodies0.5-2 mg/L culture
E. coli C43(DE3)Better for toxic membrane proteinsLower expression levels0.2-1 mg/L culture
E. coli Lemo21(DE3)Tunable expression levelRequires optimization0.3-1.5 mg/L culture
Native V. harveyiProper folding environmentChallenging genetic manipulation<0.1 mg/L culture

Expression Construct Design:

  • Signal sequence considerations:

    • Retain native V. harveyi Lgt signal sequence for proper membrane targeting

    • Alternative: replace with E. coli Lgt signal sequence for better expression in E. coli hosts

  • Affinity tags:

    • C-terminal tags preferred (as C-terminus faces cytoplasm)

    • Options include His6, Strep-tag II, or FLAG tag

    • Consider TEV protease cleavage site for tag removal

  • Fusion partners to enhance solubility:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

Membrane Extraction Protocols:

  • Detergent screening critical for functional extraction (DDM, LDAO, or Triton X-100)

  • Two-phase extraction using mild detergents followed by affinity purification

  • Consider nanodiscs or amphipols for stabilizing purified Lgt

The choice of expression system should be validated by enzymatic activity assays to confirm that the recombinant V. harveyi Lgt retains its catalytic function, which can be measured through the standard glycerol phosphate release assay described previously .

How can Lgt-deficient V. harveyi strains be generated and characterized?

Creating and characterizing Lgt-deficient V. harveyi strains presents unique challenges but provides valuable insights into Lgt function. The following methodological approach is recommended:

Generation of Lgt-deficient Strains:

  • Inducible deletion system:

    • Construct a plasmid with the V. harveyi lgt gene under control of an inducible promoter

    • Replace the chromosomal lgt with an antibiotic resistance marker

    • The plasmid-encoded Lgt sustains growth until inducer is removed

  • CRISPR-Cas9 system:

    • Design gRNAs targeting the lgt gene

    • Include homology-directed repair template with antibiotic resistance

    • Apply stress conditions to enhance transformation efficiency:

      • Heat shock (40°C for 60 minutes)

      • Ethanol treatment (16% for 10 minutes)

  • Homologous recombination:

    • Construct suicide plasmid with lgt flanking regions

    • Transfer to V. harveyi using optimized conjugation protocols

    • Select for integration and then counter-select for excision

Phenotypic Characterization:

PhenotypeAssay MethodExpected Outcome in Lgt-deficient Strains
Membrane integrityCrystal violet uptakeIncreased dye uptake
Antibiotic sensitivityMinimum inhibitory concentration (MIC)Decreased MICs for multiple antibiotics
Serum resistanceSerum survival assayIncreased killing by normal serum
Outer membrane protein profilingSDS-PAGE analysisAltered lipoprotein migration patterns
BioluminescenceLuminometer readingsPotential alterations in quorum sensing-regulated luminescence
VirulenceInfection model (e.g., marine organisms)Attenuated virulence

Verification of Lgt Deficiency:

  • PCR confirmation of genetic modification

  • Western blot analysis of unprocessed lipoproteins

  • Mass spectrometry to detect accumulation of unmodified preprolipoproteins

  • Complementation studies with wild-type lgt to confirm phenotype specificity

The stress-induced methods for enhancing V. harveyi transformation efficiency are particularly valuable for generating these genetic modifications, as they address a key technical challenge in V. harveyi molecular biology.

What analytical methods can determine the substrate specificity of V. harveyi Lgt?

Understanding the substrate specificity of V. harveyi Lgt requires sophisticated analytical approaches that can identify both natural substrates and enzyme preferences. The following methodological framework is recommended:

Biochemical Assays for Substrate Preference:

  • Peptide library screening:

    • Synthesize peptide libraries based on V. harveyi lipoprotein signal sequences

    • Vary amino acids flanking the conserved cysteine (+1 position)

    • Measure reaction rates using the glycerol phosphate release assay

  • Lipid substrate analysis:

    • Test various phospholipid donors (phosphatidylglycerol, phosphatidylethanolamine, cardiolipin)

    • Vary fatty acid composition (chain length, saturation)

    • Quantify diacylglyceryl transfer efficiency

Structural and Computational Methods:

  • Homology modeling:

    • Generate V. harveyi Lgt structural model based on related bacterial Lgt proteins

    • Identify substrate binding pocket and catalytic residues

    • Predict substrate interactions through molecular docking

  • Site-directed mutagenesis:

    • Target predicted substrate binding residues

    • Create alanine scanning library of potential interaction sites

    • Assess impact on activity with various substrates

Proteomic Identification of Natural Substrates:

  • Comparative lipoproteomic analysis:

    • Isolate membrane fractions from wild-type and Lgt-depleted V. harveyi

    • Perform mass spectrometry analysis to identify differences in lipoprotein profiles

    • Quantify unprocessed preprolipoproteins that accumulate in Lgt-depleted cells

  • Click chemistry approaches:

    • Metabolically label V. harveyi with azide-modified fatty acids

    • Perform click reaction to attach affinity tags to lipidated proteins

    • Purify and identify Lgt substrates by mass spectrometry

This comprehensive analytical approach would provide valuable insights into the substrate specificity of V. harveyi Lgt, potentially revealing unique features compared to Lgt enzymes from other bacterial species. These findings could guide the development of species-specific inhibitors targeting V. harveyi Lgt.

How does Lgt function relate to V. harveyi pathogenesis in aquaculture settings?

The relationship between Lgt function and V. harveyi pathogenesis in aquaculture has significant implications for disease management strategies. A comprehensive analysis reveals:

Lipoprotein Roles in Virulence:

  • Bacterial lipoproteins contribute to adhesion, invasion, and immune evasion

  • Lgt-processed lipoproteins may participate in biofilm formation on aquaculture surfaces

  • Proper lipoprotein processing is likely essential for V. harveyi survival in host organisms

Quorum Sensing Connections:

  • V. harveyi employs quorum sensing to regulate virulence factors like metalloprotease (vhp) and chitinase (chiA)

  • Lgt inhibition might disrupt quorum sensing networks due to altered membrane composition

  • This disruption could potentially attenuate virulence in high-density aquaculture environments

Horizontal Gene Transfer Implications:

  • Environmental stress enhances V. harveyi's ability to acquire foreign plasmids through conjugation

  • This process may facilitate the spread of virulence factors and antibiotic resistance genes

  • Lgt inhibition could potentially reduce conjugation efficiency, limiting virulence evolution

A comprehensive understanding of Lgt's role in V. harveyi pathogenesis could inform new approaches to disease control in aquaculture, potentially through targeted inhibition of Lgt function or manipulation of environmental conditions to minimize virulence expression.

How can computational approaches enhance the study of V. harveyi Lgt?

Computational methods offer powerful tools for understanding V. harveyi Lgt structure, function, and inhibition. A systematic computational approach would include:

Structural Bioinformatics:

  • Sequence analysis:

    • Multiple sequence alignment of Lgt proteins across bacterial species

    • Identification of conserved motifs specific to V. harveyi Lgt

    • Prediction of post-translational modifications

  • Homology modeling:

    • Construction of 3D structural models using related bacterial Lgt structures as templates

    • Refinement through molecular dynamics simulations

    • Validation using energy minimization and Ramachandran plot analysis

  • Membrane integration modeling:

    • Prediction of transmembrane helices and topology

    • Simulation of Lgt-membrane interactions using coarse-grained molecular dynamics

    • Analysis of membrane distortion upon substrate binding

Functional Analysis:

  • Substrate docking:

    • Virtual screening of phospholipid and peptide substrates

    • Calculation of binding energies and identification of key interaction residues

    • Molecular dynamics simulations of the enzyme-substrate complex

  • Catalytic mechanism modeling:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of reaction pathway

    • Free energy calculations for transition states

    • Identification of critical residues for catalysis

Inhibitor Discovery:

  • Pharmacophore modeling:

    • Development of pharmacophore models based on known Lgt inhibitors

    • Virtual screening of compound libraries

    • Lead optimization through structure-activity relationship analysis

  • Fragment-based drug design:

    • Identification of binding hotspots in the Lgt active site

    • In silico fragment screening and linking

    • Prediction of ADMET properties of potential inhibitors

These computational approaches would complement experimental studies, guiding hypothesis generation and experimental design while potentially accelerating the discovery of V. harveyi-specific Lgt inhibitors.

What emerging technologies could advance recombinant V. harveyi Lgt research?

Several cutting-edge technologies are poised to transform research on recombinant V. harveyi Lgt, offering new insights into its structure, function, and potential as an antimicrobial target:

Advanced Structural Biology Techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Determination of Lgt structure in lipid nanodiscs or detergent micelles

    • Visualization of conformational changes during catalysis

    • Resolution of substrate binding mechanisms

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping protein-lipid interaction surfaces

    • Identifying dynamic regions involved in substrate recognition

    • Monitoring structural changes upon inhibitor binding

  • Microcrystal electron diffraction (MicroED):

    • Structure determination from nanocrystals of Lgt

    • Higher resolution details of the active site architecture

    • Co-crystallization with substrates or inhibitors

Genome Engineering Approaches:

  • CRISPR interference (CRISPRi):

    • Tunable repression of lgt expression

    • Study of partial Lgt depletion phenotypes

    • Combination with stress response analysis

  • Base editing technologies:

    • Precise installation of point mutations in the lgt gene

    • Structure-function analysis without complete gene disruption

    • Engineering of substrate specificity variants

  • Stress-enhanced genetic manipulation:

    • Application of optimized stress conditions (heat, ethanol, etc.) to enhance transformation efficiency

    • Development of improved conjugation methods for V. harveyi

    • Creation of comprehensive mutant libraries

Systems Biology Approaches:

  • Lipidomics:

    • Comprehensive analysis of membrane lipid changes following Lgt inhibition

    • Correlation of lipidomic signatures with phenotypic outcomes

    • Identification of compensatory lipid modifications

  • Multi-omics integration:

    • Combined proteomics, transcriptomics, and metabolomics analysis

    • Network modeling of Lgt-dependent cellular processes

    • Identification of synthetic lethal interactions with Lgt inhibition

  • Single-cell analysis:

    • Heterogeneity in Lgt expression and inhibitor response

    • Real-time monitoring of membrane integrity at single-cell resolution

    • Correlation of Lgt activity with virulence factor expression

These emerging technologies will likely drive significant advances in understanding V. harveyi Lgt function and developing novel antimicrobial strategies targeting this essential enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.