Recombinant Vibrio harveyi UPF0208 membrane protein VIBHAR_02941 (VIBHAR_02941)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Vibrio harveyi UPF0208 membrane protein VIBHAR_02941 (VIBHAR_02941) is a protein derived from the bacterium Vibrio harveyi . Vibrio harveyi is a Gram-negative bacterium known to cause vibriosis, a disease affecting marine animals . Specifically, the recombinant form of this protein is produced in E. coli and tagged with histidine (His) at the N-terminal . The protein is a full-length protein consisting of 150 amino acids .

Basic Information

CategoryDescription
SpeciesVibrio campbellii
SourceE. coli
TagHis Tag (N-terminal)
Protein LengthFull Length (1-150 amino acids)
FormLyophilized powder
Gene NameVIBHAR_02941
Expression Region1-150
UniProt No.A7MVD8
AA SequenceMSKQVGLIHSLKDGQSYMEIWPVRKELNAIFPEQRIIKATRFGIKVMPAVAAISVLTQMAFNNYDSLPQAIVVALFAISMPLQGMWWLGSRSNTKLPPALASWYRELHQKITETGFALEPVKARPRYKELAVILNRAFRQLDKTALERWF

Function and characteristics

  • Membrane Protein: VIBHAR_02941 is identified as a membrane protein, suggesting it is located in the cell membrane of Vibrio harveyi .

  • UPF0208 Domain: The protein contains a UPF0208 domain, which stands for "Unknown Protein Function" . Proteins with this domain have a currently unknown function.

  • Recombinant Production: The recombinant form of this protein is produced in E. coli to facilitate research and experimentation .

Role in Vibrio harveyi

Vibrio harveyi is a bacterium known to cause disease in marine animals . It uses quorum sensing, a cell-to-cell communication process, to coordinate behaviors such as virulence . The bacterium produces autoinducers to communicate, potentially involving membrane proteins in these processes .

Applications

  • ELISA: Recombinant VIBHAR_02941 can be used in Enzyme-Linked Immunosorbent Assays (ELISA) .

Immunological Properties

  • Outer Membrane Proteins (OMPs): V. harveyi has several OMPs that are immunogenic, meaning they can elicit an immune response . These proteins are potential vaccine candidates .

  • Protective Immunity: Some OMPs can induce protective immunity, where specific antibodies block bacterial invasion . Certain OMPs may be involved in host cell interaction during infection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
VIBHAR_02941; UPF0208 membrane protein VIBHAR_02941
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
VIBHAR_02941
Target Protein Sequence
MSKQVGLIHSLKDGQSYMEIWPVRKELNAIFPEQRIIKATRFGIKVMPAVAAISVLTQMA FNNYDSLPQAIVVALFAISMPLQGMWWLGSRSNTKLPPALASWYRELHQKITETGFALEP VKARPRYKELAVILNRAFRQLDKTALERWF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Vibrio harveyi UPF0208 membrane protein VIBHAR_02941?

VIBHAR_02941 is a membrane protein from Vibrio harveyi (strain ATCC BAA-1116 / BB120) that belongs to the UPF0208 protein family. It is a full-length protein consisting of 150 amino acids with a UniProt accession number of A7MVD8. The protein is classified as a membrane protein, suggesting its involvement in cellular membrane functions, though its precise biological role remains under investigation .

What storage conditions are recommended for recombinant VIBHAR_02941?

For optimal stability and activity preservation, recombinant VIBHAR_02941 should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. For extended storage periods, conservation at -20°C or -80°C is recommended. To minimize protein degradation, repeated freezing and thawing cycles should be avoided. For short-term use, working aliquots can be maintained at 4°C for up to one week .

What challenges might researchers encounter when expressing full-length VIBHAR_02941?

Researchers working with VIBHAR_02941 may encounter several expression challenges:

  • Hydrophobicity issues: As a membrane protein, VIBHAR_02941 contains hydrophobic regions that can complicate expression in conventional systems. These regions may cause protein aggregation or improper folding.

  • Codon optimization problems: Expression may be hindered by rare codons in the VIBHAR_02941 sequence, particularly when expressing in heterologous systems like E. coli.

  • Truncation concerns: Researchers may obtain truncated products due to either proteolysis or improper translation initiation.

  • Membrane integration difficulties: Ensuring proper integration into membrane systems while maintaining native conformation presents significant technical challenges .

To address these issues, researchers should consider codon optimization, use of specialized expression systems designed for membrane proteins, and fusion tags at both N and C termini to facilitate detection of full-length expression products .

How can structural analysis of VIBHAR_02941 contribute to understanding its function?

Structural analysis of VIBHAR_02941 provides critical insights into its function through several mechanisms:

  • Three-dimensional arrangement: Determining the spatial configuration of VIBHAR_02941's transmembrane domains helps identify potential binding sites and interaction interfaces.

  • Functional domain identification: Structural studies can reveal conserved domains that suggest specific biochemical functions or involvement in signaling pathways.

  • Protein-protein interaction sites: Structural data can highlight regions likely to mediate interactions with other cellular components.

  • Evolutionary relationships: Structural comparison with related proteins can uncover evolutionary conservation patterns that indicate functional importance.

The increasing accuracy of AI-based protein structure prediction technologies, such as AlphaFold2, has enhanced our ability to predict the three-dimensional structure of proteins like VIBHAR_02941, facilitating more targeted functional studies even before crystal structures are available .

What experimental approaches are recommended for studying membrane protein VIBHAR_02941 expression?

When designing experiments to study VIBHAR_02941 expression, researchers should consider the following methodological approaches:

Experimental ApproachApplication to VIBHAR_02941Key Considerations
Expression system selectionSpecialized systems for membrane proteins (e.g., insect cells, mammalian cells)Match system to research goals; consider native lipid environment
Fusion tag strategyN-terminal and C-terminal tags to verify full-length expressionBalance between detection needs and functional interference
Codon optimizationModify rare codons in expression vectorHost-specific optimization required
Membrane extractionNanoscale cell membrane particlesMaintain native conformation and activity
Expression verificationWestern blot, mass spectrometryConfirm both size and identity

How should researchers design experiments to investigate VIBHAR_02941's role in Vibrio harveyi?

To effectively investigate the biological role of VIBHAR_02941 in Vibrio harveyi, a multi-faceted experimental design approach is recommended:

  • Gene knockout/knockdown studies: Create VIBHAR_02941-deficient strains and characterize phenotypic changes in growth, membrane integrity, and response to environmental stressors.

  • Complementation assays: Reintroduce wild-type or mutated versions of VIBHAR_02941 to knockout strains to confirm phenotype restoration or alteration.

  • Protein localization studies: Use fluorescently tagged versions of VIBHAR_02941 to determine subcellular localization under different conditions.

  • Interactome analysis: Employ pull-down assays coupled with mass spectrometry to identify protein interaction partners.

  • Comparative genomics: Analyze the presence and conservation of VIBHAR_02941 across Vibrio species to infer evolutionary significance.

When designing these experiments, researchers should include appropriate controls and ensure standardized experimental procedures to reduce variability, as emphasized in statistical best practices for experimental design .

What statistical approaches are recommended for analyzing experimental data on VIBHAR_02941?

When analyzing experimental data related to VIBHAR_02941, researchers should employ appropriate statistical methods based on the experiment type:

  • Expression level comparisons: Use parametric tests (t-tests or ANOVA) if data is normally distributed, or non-parametric alternatives (Mann-Whitney U or Kruskal-Wallis) if assumptions of normality are violated.

  • Protein activity measurements: Calculate both measures of central tendency (mean, median) and variability (standard deviation, interquartile range) to fully characterize the data.

  • Correlation analyses: When examining relationships between VIBHAR_02941 expression and other variables, calculate appropriate correlation coefficients and test for statistical significance.

  • Effect size calculation: Beyond p-values, determine effect sizes to quantify the magnitude of experimental effects, which is crucial for assessing biological significance.

  • Meta-analysis opportunities: When combining results across multiple studies, consider meta-analytic approaches to increase statistical power .

The choice of statistical test should be guided by a decision tree approach based on the experimental design, number of variables, and data characteristics. When reporting results, researchers should present both descriptive statistics and inferential statistics with appropriate measures of variability .

How can researchers address variability in VIBHAR_02941 expression experiments?

Addressing variability in VIBHAR_02941 expression experiments requires systematic approaches:

  • Variability assessment: Calculate standard deviations and coefficients of variation across technical and biological replicates to quantify the extent of variability.

  • Standardized protocols: Implement rigorous standardization of experimental procedures, including consistent cell densities, induction timing, and extraction methods.

  • Control inclusion: Incorporate appropriate positive and negative controls in each experiment to normalize across experimental batches.

  • Statistical power analysis: Determine optimal sample sizes a priori using power analysis to ensure sufficient statistical power for detecting biologically meaningful effects.

  • Blocking designs: Consider blocking experimental designs to account for known sources of variation such as different batches or days.

  • Data transformation: When appropriate, apply mathematical transformations to stabilize variance before statistical analysis.

When variability is large, it becomes more difficult to regard measures of central tendency as dependable guides to representative performance. This principle applies to detecting the effects of experimental treatments on VIBHAR_02941 expression, similar to distinguishing radio signals from static noise. A strong signal (effect) relative to the static (variability) is easily detected, while a weak signal may be lost in noise .

How can researchers effectively utilize the "People also ask" feature to enhance their VIBHAR_02941 research?

The "People also ask" (PAA) feature in Google search results can serve as a valuable tool for researchers studying specialized topics like VIBHAR_02941:

  • Identifying knowledge gaps: The questions that appear in PAA boxes can highlight areas where researchers and the scientific community are seeking information, potentially revealing unexplored research directions.

  • Research question formulation: The hierarchical and branching nature of PAA questions can help researchers develop more comprehensive research questions by revealing related subtopics.

  • Literature review enhancement: PAA questions can guide more effective literature searches by suggesting alternative terminology or related concepts that might otherwise be overlooked.

  • Content organization: For researchers preparing manuscripts or presentations, the structure of PAA questions can inform logical organization of information from basic concepts to more specialized applications.

Since approximately 86% of queries starting with when, why, how, what, and who trigger the PAA box, researchers can strategically formulate their searches using these question formats to maximize discovery of relevant information about VIBHAR_02941 or related proteins .

What methods should be used to evaluate the purity and integrity of recombinant VIBHAR_02941 preparations?

To ensure the reliability of experimental results, researchers must rigorously evaluate the purity and integrity of recombinant VIBHAR_02941 preparations using multiple complementary techniques:

Analytical MethodPurposeKey Metrics
SDS-PAGESize verification and purity assessmentBand integrity, absence of degradation products
Western blotIdentity confirmationSpecific antibody recognition
Mass spectrometryPrecise molecular weight determination and sequence verificationMass accuracy, sequence coverage
Size exclusion chromatographyOligomeric state assessment and aggregation detectionElution profile, molecular weight calibration
Circular dichroismSecondary structure verificationSpectral characteristics typical of membrane proteins
Dynamic light scatteringHomogeneity evaluationSize distribution, polydispersity index

For membrane proteins like VIBHAR_02941, additional quality control steps should include verification of proper membrane incorporation and orientation using protease protection assays or fluorescence-based techniques. Researchers should establish acceptance criteria for each quality parameter based on the specific requirements of downstream applications .

What emerging technologies might advance our understanding of VIBHAR_02941 function?

Several cutting-edge technologies hold promise for elucidating the function of membrane proteins like VIBHAR_02941:

  • Cryo-electron microscopy: Advanced cryo-EM techniques are increasingly capable of resolving membrane protein structures at near-atomic resolution, potentially revealing critical structural features of VIBHAR_02941.

  • AI-based protein structure prediction: Tools like AlphaFold2 continue to improve in accuracy and can provide valuable structural insights even when experimental structures are unavailable.

  • Single-molecule techniques: Methods such as single-molecule FRET can reveal dynamic conformational changes in membrane proteins under various conditions.

  • Native mass spectrometry: This technique allows analysis of intact membrane protein complexes, potentially identifying interaction partners of VIBHAR_02941.

  • Nanoscale membrane particle platforms: These platforms maintain the native environment of membrane proteins while facilitating purification and functional studies .

The integration of these technologies with traditional biochemical and molecular biology approaches will likely accelerate our understanding of VIBHAR_02941's structural features and functional significance in Vibrio harveyi biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.