Recombinant Vibrio harveyi UPF0761 membrane protein VIBHAR_00593 (VIBHAR_00593)

Shipped with Ice Packs
In Stock

Description

Production and Purification

  • Cloning: Full-length VIBHAR_00593 gene (1-314 aa) cloned into E. coli vectors .

  • Expression: Induced under optimized conditions for soluble protein yield.

  • Purification: Immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography .

  • Reconstitution: Solubilized in deionized water or glycerol-containing buffers (5–50%) for long-term stability .

4.1. Vaccine Development

  • Rationale: Outer membrane proteins (OMPs) like OmpK and OmpU in Vibrio harveyi are vaccine targets due to their immunogenicity .

  • Potential Use: VIBHAR_00593 could serve as a subunit vaccine candidate, though direct evidence is lacking .

4.2. Pathogenesis Studies

  • Context: Vibrio harveyi hemolysins (e.g., VhhA/B) and flagellin (VhFliA) are linked to virulence and host immune evasion .

  • Hypothesis: VIBHAR_00593 may interact with host cells or other bacterial proteins, but functional studies are needed .

Comparative Analysis with Related Proteins

ProteinFunctionExpression SystemKey Difference
VhFliA (Flagellin)TLR5 agonist, immune activationE. coliWell-characterized immunostimulatory role
OmpK-OmpU FusionVaccine antigen (81.8% survival)E. coliValidated protective efficacy in fish
VIBHAR_00593Hypothetical membrane proteinE. coliUncharacterized, no in vivo data

Challenges and Future Directions

  • Functional Annotation: No experimental data on enzymatic activity or ligand binding .

  • Immune Response: Requires animal models to test antibody cross-reactivity or adjuvanticity.

  • Interactome Mapping: Potential partners (e.g., hemolysins, quorum-sensing regulators) remain unexplored .

Quality Control and Validation

  • Endotoxin Levels: Not explicitly stated but typically <1 EU/µg for E. coli-derived proteins.

  • Activity Assays: Lacking functional validation; suppliers recommend Western blot or ELISA for detection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
VIBHAR_00593; UPF0761 membrane protein VIBHAR_00593
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Target Names
VIBHAR_00593
Target Protein Sequence
MNQLSESYKVRLSKLVPGSVAFFQYLLKRMTHDRVNVNAGYLAYITLLSIVPMLTVLLSI LSKFPVFENVGETLQGYIIDNFVPASGDAVRTALQEFVSNTGKMTAVGGAFLFVAALMLI SNIDKNLNYIWRVKDKRRPVFSFSMYWMVLTLGPILVGASIAVTSYVTSLKLIENETLTG AYNLFLRWLPLLLSFFAFMGLYFLVPNKKVYLSHGAIGAAIAAVLFELSKKGFAFYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAALGEREHWSDDLEMIHSTAELQLTD EGSESRDSANSTSQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant VIBHAR_00593 protein typically expressed and purified?

The standard expression protocol for VIBHAR_00593 utilizes E. coli as the heterologous host system with an N-terminal His-tag for purification purposes. The methodological approach involves:

  • Cloning: The coding sequence is inserted into an expression vector with an N-terminal His-tag

  • Transformation: The construct is transformed into an E. coli expression strain

  • Induction: Protein expression is induced using IPTG or similar inducers

  • Lysis: Bacterial cells are lysed using mechanical or chemical methods

  • Purification: The protein is purified using Ni-NTA affinity chromatography

  • Quality control: Verification by SDS-PAGE with purity typically greater than 90%

  • Storage: The purified protein is lyophilized and stored at -20°C/-80°C

For membrane proteins like VIBHAR_00593, detergent solubilization during extraction and purification is critical for maintaining native structure and function.

What are the optimal storage and handling conditions for recombinant VIBHAR_00593?

Based on empirical data from similar membrane proteins and specific information about VIBHAR_00593, the following storage and handling protocols are recommended:

ParameterRecommendationNotes
Storage temperature-20°C to -80°CLong-term storage
Working temperature4°CFor up to one week
Storage bufferTris/PBS-based, pH 8.0, with 6% TrehaloseStabilizes protein structure
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLReconstitute immediately before use
Cryoprotectant5-50% glycerol (final concentration)50% glycerol is standard
AliquotingMultiple small-volume aliquotsAvoids repeated freeze-thaw cycles

Repeated freezing and thawing should be avoided as it may lead to protein denaturation and loss of functional activity. For optimal results, centrifuge the vial briefly before opening to bring contents to the bottom .

How should I design experiments to study VIBHAR_00593 protein function?

When designing experiments to investigate VIBHAR_00593 function, follow these systematic steps:

  • Define your variables clearly:

    • Independent variable: Different conditions affecting VIBHAR_00593 (e.g., temperature, pH, ligands)

    • Dependent variable: Measurable outcomes (e.g., protein activity, binding affinity)

    • Control variables: Factors held constant across experimental conditions

  • Formulate specific testable hypotheses: For example, "VIBHAR_00593 exhibits increased transport activity at pH 7.5 compared to pH 6.5"

  • Establish appropriate controls:

    • Positive control: Known functional membrane protein

    • Negative control: Denatured or mutated VIBHAR_00593

    • Vehicle control: Buffer-only conditions

  • Consider experimental treatments:

Treatment TypeExample for VIBHAR_00593
EnvironmentalTemperature, pH, ionic strength variations
ChemicalPotential ligands, inhibitors, activators
GeneticSite-directed mutagenesis of key residues
StructuralTruncation variants, domain swapping
  • Plan measurements with precision: Select techniques appropriate for membrane proteins, such as:

    • Liposome reconstitution assays

    • Electrophysiology

    • Fluorescence-based activity assays

    • Binding studies using surface plasmon resonance

What are the methodological challenges in studying membrane proteins like VIBHAR_00593?

Membrane proteins present several methodological challenges that require specific strategies:

  • Solubilization issues:

    • Challenge: Maintaining native structure while extracting from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) at varying concentrations; consider newer amphipols or nanodiscs for stabilization

  • Expression problems:

    • Challenge: Toxicity or inclusion body formation in E. coli

    • Solution: Optimize using lower induction temperatures (16-20°C), weaker promoters, or specialized E. coli strains (C41/C43, Lemo21)

  • Purification difficulties:

    • Challenge: Detergent micelles interfering with purification

    • Solution: Adapt chromatography conditions with detergent in all buffers; consider on-column detergent exchange

  • Functional assays:

    • Challenge: Determining activity in artificial systems

    • Solution: Reconstitute in liposomes of defined composition; use fluorescent probes to monitor transport/activity

  • Structural analysis:

    • Challenge: Obtaining structural data

    • Solution: Consider newer techniques like cryo-EM for membrane proteins resistant to crystallization

How can fluorescent protein tagging be applied to study VIBHAR_00593 localization and dynamics?

Fluorescent protein tagging represents a powerful approach for investigating VIBHAR_00593 localization and dynamics. Based on methodologies used with other Vibrio harveyi proteins, the following systematic approach is recommended:

  • Construct design:

    • C-terminal vs. N-terminal tagging: Consider both options, as VIBHAR_00593's membrane topology may affect tag accessibility

    • Fluorescent protein selection: GFP and RFP have been successfully used with Vibrio harveyi proteins

    • Linker optimization: Include flexible linkers (e.g., GGGGS repeats) to minimize functional interference

  • Genetic modification approach:

    • Triparental mating has proven effective for introducing fluorescent protein genes into Vibrio harveyi

    • Alternatively, consider vector-based transformation systems optimized for Vibrio species

  • Validation steps:

    • Confirm expression via Western blotting

    • Verify fluorescence via microscopy

    • Check for altered phenotypes (growth rate, morphology)

    • Perform genomic analysis to confirm integration position

  • Applications:

    • Real-time visualization of VIBHAR_00593 localization within bacterial membranes

    • Investigation of protein dynamics during environmental changes

    • Co-localization studies with other proteins to identify functional complexes

What approaches are recommended for studying protein-protein interactions involving VIBHAR_00593?

To investigate protein-protein interactions involving VIBHAR_00593, consider these methodological approaches, progressing from in vitro to in vivo techniques:

  • In vitro binding assays:

    • Pull-down assays using His-tagged VIBHAR_00593 as bait

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Crosslinking approaches:

    • Chemical crosslinking with MS identification of partners

    • Photo-crosslinking using unnatural amino acids incorporated at specific positions

  • Genetic approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Genetic suppressor screens to identify functional partners

  • Advanced imaging techniques:

    • Förster resonance energy transfer (FRET) between fluorescently tagged proteins

    • Bimolecular fluorescence complementation (BiFC)

    • Single-molecule tracking to observe co-localization

  • Proteomics strategies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX) adapted for bacterial systems

When designing these experiments, it's critical to include appropriate controls for non-specific interactions, which are particularly problematic with hydrophobic membrane proteins. Consider parallel experiments with mutated versions of VIBHAR_00593 to validate specific interaction sites .

How can comparative genomic approaches enhance understanding of VIBHAR_00593 function?

Comparative genomic analysis provides valuable insights into VIBHAR_00593 function through evolutionary context. This approach involves:

  • Homology identification:

    • BLAST searches across bacterial genomes

    • HMM-based searches to identify distant homologs

    • Structural homology detection using tools like HHpred

  • Phylogenetic analysis:

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Identification of conserved domains and variable regions

    • Detection of co-evolution patterns with other genes

  • Genomic context analysis:

    • Examination of neighboring genes for functional clues

    • Identification of operonic structures

    • Analysis of regulatory elements in promoter regions

  • Structural prediction integration:

    • Use of AlphaFold2 or similar tools to predict protein structure

    • Mapping of conserved residues onto structural models

    • Identification of potential functional sites

  • Experimental validation:

    • Design of mutations targeting conserved residues

    • Complementation studies across species

    • Heterologous expression experiments

A comparative genomic approach has successfully identified functional domains in other Vibrio harveyi proteins (e.g., flagellin A protein, where conserved domains were mapped to immune-stimulating capabilities). Similar approaches could reveal functional domains in VIBHAR_00593 .

What are the recommended approaches for functional characterization of VIBHAR_00593?

Functional characterization of VIBHAR_00593 requires multiple complementary approaches:

  • Genetic approaches:

    • Gene knockout/knockdown studies in Vibrio harveyi

    • Complementation assays

    • Site-directed mutagenesis of conserved residues

  • Biochemical characterization:

    • ATPase/GTPase activity assays if relevant

    • Transport assays in reconstituted systems

    • Substrate binding studies

  • Structural biology integration:

    • Cryogenic electron microscopy

    • X-ray crystallography (challenging for membrane proteins)

    • NMR for specific domains or peptides

  • Phenotypic analyses:

    • Growth assays under various conditions

    • Stress response testing

    • Virulence assays in model organisms

  • Transcriptomic/proteomic impacts:

    • RNA-seq following manipulation of VIBHAR_00593

    • Proteome analysis to identify downstream effects

For membrane proteins like VIBHAR_00593, functional reconstitution in liposomes often provides the most direct evidence of activity, especially for transport functions. Consider fluorescence-based assays with appropriate reporters to monitor potential ion or small molecule transport .

How do I troubleshoot low expression or poor solubility of recombinant VIBHAR_00593?

Low expression or poor solubility are common challenges with membrane proteins like VIBHAR_00593. The following systematic troubleshooting approach is recommended:

  • Optimize expression conditions:

ParameterVariations to testNotes
Expression temperature16°C, 20°C, 25°C, 30°CLower temperatures often improve folding
Induction concentration0.1-1.0 mM IPTGLower concentrations may reduce toxicity
Growth mediaLB, TB, 2xYT, auto-inductionMedia richness affects expression
Cell density at inductionOD600 0.4-0.8Optimal density is strain-dependent
Expression duration4h, overnight, 24hLonger isn't always better
  • Modify the construct:

    • Try both N- and C-terminal His-tags

    • Remove potential problematic regions (flexible loops)

    • Express individual domains separately

    • Use fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Explore alternative expression systems:

    • Specialized E. coli strains (C41/C43, Lemo21)

    • Yeast expression systems (P. pastoris)

    • Insect cell expression

    • Cell-free expression systems

  • Optimize extraction and purification:

    • Screen detergent panel (DDM, LDAO, OG, CHAPS)

    • Test different lysis methods (sonication, high pressure, chemical)

    • Include stabilizing additives (glycerol, specific lipids)

    • Consider nanodiscs or amphipols for stabilization

  • Validate protein quality:

    • Size-exclusion chromatography to assess aggregation

    • Circular dichroism to verify secondary structure

    • Thermal stability assays to optimize buffer conditions

What controls should be included when studying VIBHAR_00593 in host-pathogen interaction models?

  • Genetic controls:

    • Wild-type Vibrio harveyi strain

    • VIBHAR_00593 knockout strain

    • Complemented strain (knockout with plasmid-expressed VIBHAR_00593)

    • Strain expressing inactive VIBHAR_00593 mutant

  • Experimental controls:

    • Uninfected host controls

    • Host infected with non-pathogenic Vibrio species

    • Host infected with heat-killed bacteria

    • Time-course controls to establish infection progression

  • Technical controls for fluorescently tagged strains:

    • Empty vector controls

    • Control strains expressing only the fluorescent protein

    • Spectral overlap controls for multi-color imaging

    • Photobleaching controls for time-lapse experiments

  • Host response controls:

    • Age/size-matched host organisms

    • Gender-balanced cohorts if applicable

    • Host genetic background controls

    • Environmental parameter controls (temperature, salinity, etc.)

  • Analytical controls:

    • Randomization and blinding in scoring/quantification

    • Multiple biological and technical replicates

    • Statistical validation appropriate to experimental design

Recent studies with fluorescent-tagged Vibrio harveyi demonstrated the importance of these controls, particularly when assessing virulence in model organisms like gilthead seabream larvae .

How can VIBHAR_00593 research contribute to understanding Vibrio harveyi pathogenesis?

VIBHAR_00593 research has significant potential to advance our understanding of Vibrio harveyi pathogenesis through several avenues:

  • Membrane protein function in virulence:

    • Membrane proteins often serve as adhesins, invasins, or secretion system components

    • VIBHAR_00593 may participate in host attachment or invasion processes

    • Changes in VIBHAR_00593 expression during infection could indicate functional importance

  • Potential therapeutic targets:

    • Membrane proteins are accessible to antibodies and small molecules

    • Understanding VIBHAR_00593 structure could enable rational drug design

    • Conserved epitopes might serve as vaccine candidates

  • Environmental adaptation mechanisms:

    • Membrane proteins often sense environmental changes

    • VIBHAR_00593 may participate in adaptation to host conditions

    • Expression patterns across infection stages could reveal regulatory mechanisms

  • Strain-specific differences:

    • Comparative analysis across virulent and avirulent strains

    • Identification of sequence variations correlated with pathogenicity

    • Potential biomarkers for virulent strain identification

  • Host-pathogen interface studies:

    • Fluorescently tagged VIBHAR_00593 allows visualization during infection

    • Co-localization with host factors may reveal interaction mechanisms

    • Real-time tracking of bacterial distribution in host tissues

Recent studies with fluorescent-tagged Vibrio harveyi strains have demonstrated successful colonization and localization within host tissues, providing a foundation for future research on pathogen-host relationships that could be applied to VIBHAR_00593 functional studies .

What emerging technologies might enhance future studies of VIBHAR_00593?

Several cutting-edge technologies show particular promise for advancing VIBHAR_00593 research:

  • Structural biology innovations:

    • Cryo-electron microscopy advances for membrane proteins

    • Microcrystal electron diffraction (MicroED)

    • Integrative structural modeling combining multiple data sources

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing in Vibrio species

    • CRISPRi for conditional knockdown studies

    • Base editing for precise genetic modifications

  • High-resolution imaging:

    • Super-resolution microscopy (STORM, PALM) for nanoscale localization

    • Correlative light and electron microscopy (CLEM)

    • Expansion microscopy for improved resolution in bacterial studies

  • Single-cell approaches:

    • Single-cell RNA-seq to identify population heterogeneity

    • Single-molecule tracking in live cells

    • Microfluidic systems for controlled environmental manipulation

  • Computational advances:

    • Improved protein structure prediction (AlphaFold2)

    • Molecular dynamics simulations in membrane environments

    • Machine learning for functional prediction from sequence/structure

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to place VIBHAR_00593 in biological pathways

    • Mathematical modeling of membrane protein dynamics

What are the key considerations for researchers new to VIBHAR_00593 studies?

Researchers beginning work with VIBHAR_00593 should consider these essential points:

  • Protein characteristics:

    • VIBHAR_00593 is a 314 amino acid membrane protein with multiple transmembrane domains

    • It requires appropriate detergents for solubilization and stability

    • His-tagged recombinant versions are available for experimental use

  • Experimental design principles:

    • Include appropriate controls for membrane protein work

    • Consider both in vitro and in vivo approaches for functional studies

    • Validate findings across multiple experimental systems

  • Technical considerations:

    • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Reconstitution to 0.1-1.0 mg/mL in deionized sterile water

    • Addition of 5-50% glycerol for long-term storage

    • Avoidance of repeated freeze-thaw cycles

  • Research context:

    • Consider VIBHAR_00593's potential role in Vibrio harveyi pathogenesis

    • Explore comparative analyses across Vibrio species

    • Integrate findings with existing knowledge of bacterial membrane proteins

  • Collaborative opportunities:

    • Connect with Vibrio researchers and membrane protein specialists

    • Consider interdisciplinary approaches combining microbiology, structural biology, and host-pathogen interaction studies

Where can researchers find additional resources and reference materials for VIBHAR_00593 studies?

Researchers can access the following resources for VIBHAR_00593 studies:

  • Protein databases:

    • UniProt entry: A7MTU7 (contains sequence and annotation information)

    • Protein Data Bank (PDB) for structural information of homologous proteins

    • PFAM for domain information of UPF0761 family proteins

  • Genomic resources:

    • NCBI GenBank for Vibrio harveyi genome sequences

    • Integrated Microbial Genomes (IMG) system for comparative genomics

    • Vibrio Data Collection for Vibrio-specific genomic information

  • Methodological resources:

    • Membrane Protein Data Bank for protocols and techniques

    • MPDB (Membrane Proteins of Known 3D Structure) database

    • Protocols from studies of related Vibrio membrane proteins

  • Research networks:

    • International Vibrio Conference proceedings

    • Aquaculture Pathogen Research Consortium

    • Membrane Protein Structural Biology Consortium

  • Commercial resources:

    • Recombinant protein sources (as referenced in search result )

    • Specialized reagents for membrane protein research

    • Customized antibody development services

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.