Recombinant Vibrio splendidus Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Structure

Recombinant RnfE is a subunit of the Rnf complex, which plays a critical role in energy conservation and ion translocation. Key structural and functional attributes include:

PropertyDetails
Host OrganismEscherichia coli (expression system)
Species OriginVibrio tasmaniensis (closely related to V. splendidus)
Protein Length230 amino acids (Full-length)
TagHis-tag (for purification)
UniProt IDNot explicitly listed for V. splendidus (homologs: B7VLE0 in Vibrio)
NCBI Gene ID7162300 (related Vibrio gene)

The Rnf complex typically consists of multiple subunits (RnfA-G), with RnfE contributing to electron transfer and sodium ion translocation. Structural homology suggests RnfE interacts with other subunits (e.g., RnfB, RnfC) to stabilize the complex .

Functional Role in Electron Transport

The Rnf complex enables energy conservation by coupling electron flow from reduced ferredoxin to NAD+ reduction, generating a sodium ion gradient. Key findings include:

  • Electrogenic Na+ Translocation: In homologs like Acetobacterium woodii, the Rnf complex transports Na+ across membranes during ferredoxin:NAD+ oxidoreductase activity .

  • Interaction with Other Subunits: Studies in Rhodobacter capsulatus show RnfE co-immunoprecipitates with RnfB and RnfC, indicating structural interdependence .

  • Energy Conservation: The Rnf complex is critical for ATP synthesis in anaerobic bacteria, particularly under low-redox conditions .

Production and Applications

Recombinant RnfE is produced via heterologous expression in E. coli systems. Key protocols and uses include:

  • Expression and Purification: The protein is expressed with a His-tag for affinity chromatography, yielding >85% purity (SDS-PAGE verified) .

  • Research Applications:

    • Study of ion-coupled electron transport mechanisms.

    • Structural analysis of microbial respiratory complexes.

    • Comparative genomics of Vibrio pathogenicity and metabolism.

Research Gaps and Future Directions

While data on V. splendidus RnfE is limited, insights from related systems highlight:

  • Temperature-Dependent Activity: Vibrio species often regulate virulence and metabolic pathways via temperature-sensitive proteases (e.g., Vsm metalloprotease) . Whether RnfE activity is similarly modulated remains unexplored.

  • Phage Interactions: V. splendidus susceptibility to phage infection is influenced by capsular polysaccharide transporters like Wza . A potential link between RnfE and phage resistance warrants investigation.

Comparative Analysis with Homologs

OrganismRnf Complex RoleReference
Acetobacterium woodiiNa+ translocation, ATP synthesis
Rhodobacter capsulatusSubunit stability, electron transport regulation
Vibrio splendidusPutative ion transport, energy metabolism

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag, please inform us and we will prioritize its inclusion.
Synonyms
rnfE; VS_0972; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Target Names
VS_0972
Target Protein Sequence
MSDHKTLIKNGMWANNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVSVSLVR NHVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNEVLPAAQDGFWMGLGMTSVLVVLGAMREIIGNGTLFDGADLLLGDWASVLRIQIFQFD NSFLLALLPPGAFIGVGFLIALKNIIDNQAKSRQPKQEKPVIERARVTNA
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane.
Database Links

KEGG: vsp:VS_0972

STRING: 575788.VS_0972

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the RnfE protein and what is its role in Vibrio splendidus?

RnfE is a component of the electron transport complex in Vibrio splendidus, a marine bacterium that is ubiquitously present in various marine environments and associated with mortality in diverse marine animals . The RnfE protein specifically functions as part of the electron transport machinery, facilitating energy production through redox reactions. In V. splendidus strain LGP32 (also known as Mel32), this protein plays a crucial role in cellular bioenergetics and potentially in pathogenicity mechanisms .

How does the RnfE protein integrate into the pathogenicity mechanisms of V. splendidus?

While direct evidence linking RnfE to pathogenicity is limited, V. splendidus is known to infect various marine culture animals, causing significant mortality and economic losses . Electron transport proteins like RnfE may contribute to bacterial survival under the stress conditions encountered during host infection. The energy produced through electron transport systems could support various virulence mechanisms, including motility, toxin production, and resistance to host defense mechanisms, although specific pathways involving RnfE require further investigation.

What genetic manipulation techniques are recommended for studying rnfE gene function?

For studying rnfE gene function in V. splendidus, researchers can employ several genetic approaches:

  • Allelic Exchange Method: A markerless allelic replacement technique using a suicide vector based on the pir-dependent R6K replicative origin can efficiently create gene knockouts or modifications in V. splendidus . This system employs the ccdB gene under control of the PBAD promoter for counterselection, allowing efficient creation of rnfE mutants.

  • Conjugation Protocol: Transfer of genetic constructs can be performed using a filter mating procedure with a donor/recipient ratio of 1/10. Conjugation is typically performed overnight on filters incubated on plates containing ML supplemented with diaminopimelic acid and NaCl at 30°C .

  • Mutant Screening: PCR-based screening using primers flanking the rnfE gene can efficiently identify successful mutants. Expected amplicon size differences between wild-type and mutant strains should be calculated based on the specific deletion or modification strategy .

What expression systems are optimal for producing recombinant RnfE protein?

For membrane proteins like RnfE, expression systems should be carefully selected to ensure proper folding and integration. Based on successful approaches with similar proteins:

Expression SystemAdvantagesChallengesNotes for RnfE
E. coli BL21(DE3)High yield, well-established protocolsMay not properly fold membrane proteinsRequires optimization of growth temperature and inducer concentration
V. splendidus nativeAuthentic post-translational modificationsLower yields, more complex genetic manipulationCan use arabinose-inducible PBAD promoter system
Cell-free systemsAvoids toxicity issuesHigher cost, lower scaleUseful for preliminary functional studies

When expressing RnfE, consider using the arabinose-inducible PBAD promoter system, which has been demonstrated to function efficiently in V. splendidus with tight regulation and proper induction in response to arabinose .

What purification approaches are most effective for RnfE protein?

Purification of membrane proteins like RnfE requires specialized approaches:

  • Membrane Fraction Isolation: Begin with gentle cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent Solubilization: Select appropriate detergents for solubilization testing (e.g., DDM, LDAO, or SMA copolymers) that maintain protein structure and function.

  • Affinity Purification: Utilize affinity tags incorporated into the recombinant protein. The commercially available RnfE protein includes tag technology optimized for the specific protein characteristics .

  • Size Exclusion Chromatography: As a final polishing step to separate protein aggregates and ensure monodispersity.

  • Quality Control: Verify purity using SDS-PAGE and Western blotting, and assess functional integrity through activity assays.

How can researchers assess electron transport activity of purified RnfE?

The electron transport activity of RnfE can be evaluated using the following approaches:

  • Spectrophotometric Assays: Monitor the reduction/oxidation of artificial electron acceptors or donors (such as ferricyanide, DCPIP, or methyl viologen) at characteristic wavelengths.

  • Oxygen Consumption Measurements: Using Clark-type oxygen electrodes to measure changes in oxygen concentration when the protein is supplied with appropriate substrates.

  • Reconstitution into Liposomes: Incorporate purified RnfE into liposomes to assess membrane potential generation using voltage-sensitive fluorescent dyes.

  • Protein-Protein Interaction Studies: Identify interaction partners within the electron transport chain using techniques like pull-down assays, crosslinking, or surface plasmon resonance.

A typical experimental workflow might include:

  • Control reactions without protein

  • Reactions with heat-inactivated protein

  • Substrate concentration gradients

  • Inhibitor studies with specific electron transport chain inhibitors

What methods can be used to study the structural characteristics of RnfE?

Understanding the structural features of RnfE requires specialized techniques for membrane proteins:

  • Computational Analysis: Prediction of transmembrane domains and protein topology based on the amino acid sequence. The RnfE sequence (230 amino acids) contains multiple hydrophobic regions typical of transmembrane domains .

  • Membrane Topology Mapping: Using reporter fusions or chemical labeling to determine the orientation of different domains relative to the membrane.

  • Cryo-electron Microscopy: For higher-resolution structural analysis, particularly useful for membrane protein complexes.

  • Crosslinking Studies: To identify proximity relationships between different regions of the protein or with other complex components.

  • Circular Dichroism Spectroscopy: To assess secondary structure content and stability under different conditions.

How does RnfE function relate to virulence in V. splendidus?

To investigate potential relationships between RnfE and virulence:

  • Virulence Comparison: Compare wild-type and rnfE mutant strains in infection models. V. splendidus is known to cause mortality in various marine animals, making oyster infection models potentially useful .

  • Extracellular Product Analysis: Assess whether rnfE deletion affects production of virulence factors. Techniques similar to those used for analyzing metalloprotease activity in V. splendidus could be adapted :

    • Gelatin-SDS-polyacrylamide gel analysis

    • Azocasein assay for general protease activity

    • Immunoblotting for specific virulence factors

  • Stress Response Assessment: Determine whether rnfE contributes to bacterial survival under conditions that mimic host environments (oxidative stress, antimicrobial peptides, pH changes).

How can researchers investigate potential inhibitors of RnfE activity?

Inhibitor discovery and characterization could follow these approaches:

  • In Silico Screening: Computational docking studies using the predicted structure of RnfE to identify potential binding molecules. Similar approaches have been used for other V. splendidus proteins, as demonstrated in the tryptanthrin-LuxO interaction study .

  • Biochemical Assays: Development of activity assays suitable for high-throughput screening of compound libraries.

  • Validation Studies: Confirmation of direct binding using biophysical techniques like isothermal titration calorimetry or surface plasmon resonance.

  • Structure-Activity Relationship Analysis: Systematic modification of lead compounds to improve potency and selectivity.

Molecular Docking ApproachAdvantagesApplications for RnfE
Blind dockingIdentifies novel binding sitesInitial screening for potential binding regions
Site-directed dockingHigher precision for known binding sitesRefinement of lead compounds
Ensemble dockingAccounts for protein flexibilityImportant for membrane proteins like RnfE

Molecular docking approaches similar to those used for studying LuxO-tryptanthrin interactions could be adapted to investigate potential RnfE inhibitors .

How can researchers explore the regulatory networks involving RnfE?

To understand the regulatory context of RnfE:

  • Transcriptome Analysis: RNA-Seq comparing wild-type and stress conditions to identify co-regulated genes.

  • Promoter Analysis: Characterization of the rnfE promoter region and identification of transcription factor binding sites.

  • Reporter Fusions: Creation of transcriptional or translational fusions to monitor rnfE expression under different conditions.

  • Two-Component System Analysis: Investigation of potential regulatory systems controlling rnfE expression, potentially including quorum sensing pathways like those involving LuxO in V. splendidus .

What strategies can resolve poor expression of recombinant RnfE?

When encountering poor expression of this membrane protein:

  • Optimize Induction Conditions: Test various induction temperatures (18-30°C), inducer concentrations, and induction times. For the arabinose-inducible system in V. splendidus, careful optimization of arabinose concentration is critical .

  • Codon Optimization: Adjust the coding sequence to match the codon usage of the expression host.

  • Expression Tags: Test different fusion tags and their positions (N-terminal vs. C-terminal).

  • Toxicity Mitigation: Use tightly regulated expression systems or specialized hosts designed for toxic proteins.

  • Membrane Integration Assistance: Co-express with chaperones that assist in membrane protein folding.

How can researchers address protein instability issues with purified RnfE?

For improving stability of the purified RnfE protein:

  • Buffer Optimization: Systematically test buffers with different pH values, salt concentrations, and additives.

  • Detergent Screening: Test multiple detergents and concentrations to identify optimal solubilization conditions.

  • Stabilizing Ligands: Include known substrates or cofactors that might stabilize the protein structure.

  • Storage Conditions: Determine optimal storage temperatures and the need for glycerol or other cryoprotectants. The commercially available RnfE is stored in Tris-based buffer with 50% glycerol at -20°C .

  • Avoid Freeze-Thaw Cycles: Prepare single-use aliquots to prevent degradation from repeated freezing and thawing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.