Recombinant Vibrio splendidus Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Fumarate Reductase Complex

FrdC is a membrane-anchoring subunit in the FRD complex, which typically includes:

  • FrdA: Catalytic subunit (flavin-dependent fumarate reductase).

  • FrdB: Iron-sulfur subunit (electron transfer).

  • FrdC/FrdD: Hydrophobic anchor subunits (electron transfer from quinones to FrdB) .

Key Functions:

  1. Electron Transfer: Facilitates electron transfer from menaquinol/ubiquinol to FrdB via hydrophobic interactions .

  2. Membrane Anchoring: Positions FrdA/FrdB subunits at the cytoplasmic membrane interface .

  3. ROS Modulation: Deletion of frdC in Bacteroides fragilis reduces reactive oxygen species (ROS) production, linking FRD to oxidative stress responses .

Table 1: Functional Studies of frdC in Bacterial Pathogens

OrganismStudy FocusKey FindingsSource
Bacteroides fragilisRole in ROS production and aerotoleranceDeletion of frdC increased aerotolerance in superoxide dismutase-deficient strains
Vibrio splendidusVirulence gene regulation via Fur proteinFur downregulation upregulated Vshppd (hemolysin) and Vsm (metalloprotease)

Mechanistic Insights:

  • Electron Transfer Pathway: FrdC binds quinones (e.g., menaquinol) at hydrophobic sites, transferring electrons to FrdB .

  • Pathogenicity: In V. splendidus, FRD activity may influence biofilm formation and swarming motility, regulated by Fur .

Comparative Analysis of Recombinant frdC Proteins

SourceSpeciesPurityTagLengthApplicationsSource
Creative BiomartVibrio splendidus>90%HisFull-length (1–127aa)Research, ELISA
CusabioE. coli O157:H7>85%N/APartialImmunological studies
MyBioSourceV. splendidus (transmembrane)N/AN/AFull-lengthStructural studies

Note: The V. splendidus frdC is distinct from E. coli frdC (UniProt P0A8Q2) , highlighting species-specific structural variations.

Biotechnological and Clinical Relevance

  • Diagnostic Tools: Recombinant frdC is used in ELISA kits for detecting anti-FRD antibodies in bacterial infections .

  • Antibiotic Targets: FRD is a potential target for antimicrobial drugs in anaerobic pathogens, though direct inhibitors of frdC are not yet developed.

  • Oxidative Stress Research: Studies on ROS modulation via frdC deletion inform strategies to combat antibiotic resistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; VS_0246; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Target Names
frdC
Target Protein Sequence
MSNRKPYVRDMKRTWWSNHPFYRFYMLREATVLPLILFTLFLTFGLGSLVKGPEAWEGWL SFMANPIVVGINIVALLGSLLHAQTFFSMMPQVMPIRLKGKLVDKRIIVLTQWAAVAFIS LIVLMVV
Uniprot No.

Target Background

Function

Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.

Database Links

KEGG: vsp:VS_0246

STRING: 575788.VS_0246

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does frdC interact with other fumarate reductase subunits to form a functional complex?

Fumarate reductase typically functions as a multi-subunit complex. Based on studies of homologous systems in E. coli, the frdC subunit works in concert with frdA (flavoprotein), frdB (iron-sulfur protein), and frdD (membrane anchor protein) to form a complete functional enzyme . The association between these subunits is critical, as demonstrated by the fact that separation of the genes coding for frdC and frdD affected the ability of fumarate reductase to assemble into a functional complex in E. coli . The frdC and frdD subunits are specifically required for membrane association of the entire complex and for the oxidation of reduced quinone analogues, while the frdA and frdB dimer is responsible for the catalytic activity . This quaternary structure is essential for enabling the electron transfer chain that supports anaerobic respiration.

What are the optimal expression systems for producing recombinant V. splendidus frdC?

The optimal expression system for V. splendidus frdC utilizes E. coli as the host organism with the following specifications:

ParameterOptimal Condition
Expression HostE. coli
Vector TypepET or similar expression vectors with T7 promoter
Fusion TagN-terminal His-tag
InductionIPTG (typically 0.5-1 mM)
Growth Temperature28-37°C (lower temperatures may improve solubility)
Expression Time4-6 hours post-induction

As demonstrated in available recombinant protein products, the full-length V. splendidus frdC (amino acids 1-127) can be successfully expressed with an N-terminal His-tag in E. coli . The use of E. coli as an expression host provides significant advantages for membrane protein expression, though optimization of growth conditions may be necessary to prevent formation of inclusion bodies due to the hydrophobic nature of frdC .

What purification strategies yield the highest purity of recombinant frdC protein?

Based on established protocols for membrane proteins, the following purification strategy is recommended:

  • Cell lysis using either sonication or pressure-based methods in buffer containing detergents (typically 1% Triton X-100 or n-dodecyl β-D-maltoside)

  • Initial clarification by centrifugation (10,000-20,000 × g for 30 minutes)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin

  • Wash steps with increasing imidazole concentrations (20-50 mM)

  • Elution with high imidazole concentration (250-500 mM)

  • Size exclusion chromatography for removal of aggregates and further purification

This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE . For functional studies, maintaining the protein in detergent micelles throughout the purification process is critical for retaining native structure.

What are the recommended storage conditions for maintaining stability of purified frdC?

For optimal stability of purified V. splendidus frdC, the following storage conditions are recommended:

Storage ParameterRecommendation
Short-term storage4°C for up to one week
Long-term storage-20°C/-80°C (aliquoted)
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% Trehalose
Additives50% glycerol (recommended final concentration)
FormLyophilized powder or in solution with glycerol

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided . For reconstitution of lyophilized protein, it is recommended to centrifuge the vial prior to opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol helps maintain protein stability during freezing.

What genetic tools are available for manipulating the frdC gene in V. splendidus?

Several genetic tools have been developed specifically for V. splendidus gene manipulation:

  • pSW vector system: A suicide vector based on pir-dependent R6K replicative origin that can be transferred by RP4-based conjugation . This system includes:

    • Plasmid carrying the ccdB gene of E. coli F plasmid under control of the PBAD promoter

    • Counterselection system allowing efficient markerless allelic replacement

    • Demonstrated effectiveness in both V. splendidus and V. cholerae

  • Two-step allelic replacement method: Uses CcdB as a positive selection marker . The process involves:

    • Integration of a suicide plasmid into the target gene by homologous recombination

    • Selection for vector loss via second homologous recombination event

    • Success rates of approximately 40-50% for non-essential genes

  • Bacterial conjugation approach: Demonstrated in studies of V. splendidus virulence genes , this method involves:

    • Construction of recombinant plasmids in E. coli

    • Transfer to V. splendidus through bacterial conjugation

    • Selection on appropriate antibiotic-containing media

These genetic tools have been successfully applied to generate knockout mutants of various V. splendidus genes, including vsm, luxU, and fur, establishing their roles in pathogenicity .

How does deletion of the frdABCD operon affect V. splendidus metabolism and virulence?

The deletion of the frdABCD operon (including frdC) has significant effects on V. splendidus metabolism and potentially its virulence:

  • Metabolic impact:

    • Prevents anaerobic growth using fumarate as a terminal electron acceptor

    • Reduces carbon flow through the reductive TCA cycle under anaerobic conditions

    • Alters the redox balance of the cell during oxygen limitation

  • Virulence implications:

    • Studies in related Vibrio species demonstrate that deletion of frdABCD reduces by-product formation during fermentation

    • In engineered strains of Vibrio sp. dhg, deletion of frdABCD (alongside ldhA and pflB) minimized carbon loss to by-products and improved ethanol production

    • The efficiency of colonization in marine hosts may be affected due to altered ability to persist under the low-oxygen conditions often encountered in infected tissues

This is supported by findings in Vibrio sp. dhg, where deletion of frdABCD alongside other genes involved in alternative fermentation pathways reduced total by-product formation to only 1.1 g/L while improving the production of desired metabolites . The role of frdC specifically within this complex appears to be essential for membrane association and electron transport capabilities.

What experimental approaches can be used to study frdC protein interactions within the membrane?

The following experimental approaches are recommended for studying frdC protein interactions:

  • Bacterial two-hybrid system: Modified for membrane proteins to identify protein-protein interactions

    • Uses fusion proteins that reconstitute a functional transcription factor when interaction occurs

    • Can be adapted for membrane proteins using specialized vectors

  • Co-immunoprecipitation with crosslinking:

    • Chemical crosslinking to stabilize transient interactions

    • Detergent solubilization of membrane fractions

    • Immunoprecipitation using antibodies against tagged frdC

    • Mass spectrometry analysis of co-precipitated proteins

  • Blue native PAGE analysis:

    • Isolation of membrane fractions

    • Solubilization using mild detergents

    • Separation of intact protein complexes by blue native PAGE

    • Western blot or mass spectrometry for identification of complex components

  • Fluorescence resonance energy transfer (FRET):

    • Expression of frdC and potential interaction partners with appropriate fluorescent tags

    • Measurement of energy transfer between fluorophores as indicator of protein proximity

    • Particularly useful for dynamic interaction studies in living cells

These approaches have been successfully applied to membrane protein studies in various bacterial systems and can be adapted specifically for V. splendidus frdC research.

How does frdC expression change under different environmental conditions relevant to V. splendidus pathogenicity?

The expression of frdC is modulated by several environmental factors relevant to V. splendidus pathogenicity:

Environmental ConditionEffect on frdC ExpressionRegulatory Mechanism
Oxygen limitationUpregulationFNR-like transcription factors
Iron availabilityRegulation via FurFur protein binding to promoter region
Host-associated factorsPotential inductionContact with coelomic fluids
Growth phaseHigher in stationary phaseRpoS-dependent regulation

The Ferric uptake regulator (Fur) plays an important role in regulating virulence-related genes in V. splendidus . While direct evidence of Fur regulation of frdC in V. splendidus is not explicitly documented in the search results, studies in related bacteria demonstrate that Fur can regulate genes involved in anaerobic metabolism, including fumarate reductase components . The fumarate reductase genes are typically induced under anaerobic conditions to support alternative respiratory pathways when oxygen is limited, which is relevant to infection environments .

What is the relationship between frdC function and V. splendidus biofilm formation?

The relationship between frdC and biofilm formation involves several interconnected mechanisms:

  • Metabolic contribution to biofilm microenvironment:

    • Fumarate reductase activity supports growth in the oxygen-limited conditions that develop within biofilms

    • The metabolic activities of frdABCD contribute to redox balancing within biofilm structures

  • Biofilm regulation and Fur involvement:

    • Studies of V. splendidus demonstrate that Fur regulates biofilm formation

    • A Fur knock-down mutant showed "remarkably decreased" biofilm formation compared to wild-type in both normal and iron-replete conditions

    • As a potential Fur-regulated gene, frdC may be part of the regulatory network connecting metabolism to biofilm development

  • Persistence mechanisms:

    • V. splendidus can form persister cells that contribute to biofilm resistance

    • Metabolic adaptations, potentially including shifts in fumarate reductase activity, may contribute to the persister cell phenotype

Research on V. splendidus demonstrates that biofilm formation is linked to virulence and colonization abilities, with mutants showing reduced biofilm formation also exhibiting reduced colonization abilities in hosts like Apostichopus japonicus .

What methodologies can be used to evaluate the role of frdC in host colonization by V. splendidus?

To evaluate the role of frdC in host colonization, the following methodologies are recommended:

  • Construction of frdC knockout strains:

    • Using the genetic tools described in section 3.1

    • Including complementation strains to confirm phenotype specificity

    • Real-time qPCR validation of knockout efficiency

  • Colonization assays using marine hosts:

    • Exposure of model hosts (e.g., Apostichopus japonicus) to wild-type and ΔfrdC V. splendidus

    • Quantification of bacterial loads in various tissues (muscle, intestine, tentacle, coelomic fluid)

    • Time-course analysis to assess colonization dynamics

  • Competitive index experiments:

    • Co-infection with wild-type and mutant strains (differentially tagged)

    • Calculation of competitive index as ratio of mutant:wild-type recovery

    • Assessment of tissue-specific competitive advantages

  • In vitro host cell interaction models:

    • Establishment of marine invertebrate cell lines

    • Measurement of adhesion, invasion, and persistence capabilities

    • Analysis of host cell responses to wild-type versus ΔfrdC strains

This approach follows established protocols used to study other V. splendidus virulence factors, such as Fur, where colonization abilities in various tissues of Apostichopus japonicus were assessed . The median lethal dose (LD50) of wild-type versus mutant strains can provide quantitative measures of virulence attenuation.

How can recombinant frdC be used to develop vaccines against V. splendidus infections in aquaculture?

Recombinant frdC protein offers several advantages as a vaccine candidate against V. splendidus infections:

  • Immunogenicity assessment:

    • Purified recombinant frdC can be evaluated for immunogenicity in target aquaculture species

    • ELISA-based methods to measure antibody responses following immunization

    • Challenge studies to assess protection levels

  • Vaccine formulation approaches:

    • Subunit vaccines incorporating purified frdC protein with appropriate adjuvants

    • DNA vaccines expressing frdC under control of eukaryotic promoters

    • Attenuated V. splendidus strains with modified frdC expression

  • Delivery method optimization:

    Delivery MethodAdvantagesDisadvantages
    InjectionPrecise dosing, strong responseLabor intensive, stress to animals
    ImmersionMass application, less stressVariable uptake, higher doses needed
    Oral deliveryEasy administrationDegradation in digestive tract
  • Cross-protection evaluation:

    • Assessment of protection against different V. splendidus strains

    • Potential for protecting against related Vibrio species

The development of such vaccines would require comparison with other immunogens and comprehensive safety and efficacy testing in relevant aquaculture species.

What are the challenges in developing specific inhibitors targeting V. splendidus frdC?

Developing specific inhibitors targeting V. splendidus frdC presents several significant challenges:

  • Structural considerations:

    • The membrane-embedded nature of frdC complicates structural studies

    • Limited structural information available specifically for V. splendidus frdC

    • Need for membrane protein crystallization or advanced structural determination techniques

  • Specificity requirements:

    • High sequence and structural similarity between bacterial fumarate reductase components

    • Challenge of achieving specificity for V. splendidus vs. other environmental Vibrio species

    • Potential for cross-reactivity with host enzymes

  • Compound characteristics needed:

    • Lipophilicity required for penetrating bacterial membranes

    • Stability in marine environments if used in aquaculture settings

    • Low toxicity to non-target marine organisms

  • Testing methodology limitations:

    • Need for specialized assays to measure inhibition of membrane-bound enzyme complexes

    • Requirement for validated in vitro and in vivo models specific to V. splendidus infections

Overcoming these challenges would require interdisciplinary approaches combining structural biology, medicinal chemistry, and microbiological testing in relevant marine models.

How does the genomic diversity of V. splendidus strains affect frdC function and expression?

Analysis of genomic diversity among V. splendidus strains reveals important considerations regarding frdC:

  • Strain diversity impact:

    • Genomic studies confirm "high genotypic diversity" within V. splendidus species

    • Comparison of multiple strains (LGP32, 12B01, and Med222) identified numerous strain-specific regions

    • This diversity likely extends to frdC sequence, regulation, and potentially function

  • Horizontal gene transfer considerations:

    • V. splendidus strains can acquire genetic material through horizontal gene transfer

    • Chromosomal integrons, often sources of genetic diversity, show variable presence across strains

    • The frd operon may be subject to similar evolutionary pressures and genetic exchange

  • Host adaptation implications:

    • Different strains adapt to different marine hosts and ecological niches

    • The metabolic requirements for growth and survival vary accordingly

    • frdC expression and function may be optimized for specific host environments

This genomic diversity presents challenges for developing universal detection methods or treatments targeting frdC, but also provides opportunities for studying adaptive evolution in response to different ecological niches.

What are common problems in expressing and purifying recombinant V. splendidus frdC and how can they be addressed?

Common challenges and their solutions in frdC expression and purification include:

ChallengeCauseSolution
Poor expressionToxicity to host cellsUse tightly regulated expression systems; lower induction temperature to 16-20°C
Inclusion body formationHydrophobic nature of membrane proteinAdd detergents during lysis; consider fusion tags that enhance solubility
Loss of protein during purificationProtein aggregation or membrane associationOptimize detergent concentration; avoid harsh washing conditions
Low purityNon-specific binding to chromatography resinIncrease imidazole in wash buffers; add additional purification steps
Protein inactivityDenaturation during purificationMaintain native-like lipid environment; consider protein reconstitution into nanodiscs

During reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom. Avoiding repeated freeze-thaw cycles is essential for maintaining protein integrity .

What controls should be included when studying frdC function in V. splendidus?

When studying frdC function, the following controls should be included:

  • Genetic controls:

    • Wild-type V. splendidus strain(s)

    • ΔfrdC mutant strain

    • Complemented ΔfrdC strain (restoring wild-type phenotype)

    • Strains with mutations in other frd operon genes for comparison

  • Expression controls:

    • RT-qPCR measurement of frdC expression under test conditions

    • Western blot confirmation of protein levels when studying functionality

    • Reporters fused to frdC promoter to monitor expression dynamics

  • Functional assays controls:

    • Positive control for fumarate reductase activity (e.g., E. coli with known activity)

    • Negative control (heat-inactivated enzyme preparations)

    • Validation of assay specificity using specific inhibitors

  • Environmental condition controls:

    • Aerobic vs. anaerobic growth conditions

    • Defined media with controlled iron availability

    • Host-relevant temperatures and salinities

Inclusion of these controls ensures proper interpretation of experimental results and helps distinguish frdC-specific effects from other biological variables.

How can interactions between frdC and other components of the fumarate reductase complex be accurately measured?

To accurately measure interactions between frdC and other fumarate reductase components:

  • Surface Plasmon Resonance (SPR):

    • Immobilization of purified frdC (or other subunits) on sensor chip

    • Measurement of real-time binding kinetics with potential interaction partners

    • Determination of association and dissociation constants

  • Isothermal Titration Calorimetry (ITC):

    • Label-free measurement of thermodynamic parameters

    • Quantification of binding affinity, stoichiometry, and enthalpy changes

    • Particularly useful for detergent-solubilized membrane proteins

  • Functional reconstitution:

    • Purification of individual components (frdA, frdB, frdC, frdD)

    • Systematic reconstitution experiments combining different subunits

    • Measurement of enzyme activity as function of complex formation

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of protein complexes in native membranes

    • Digestion and mass spectrometry analysis

    • Identification of specific interaction sites between subunits

Studies in E. coli have demonstrated that all four fumarate reductase subunits must be present and properly assembled for functional activity, with the FrdA-FrdB dimer being active in the benzyl viologen oxidase assay but requiring FrdC and FrdD for membrane association and quinone interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.