Recombinant Vibrio splendidus Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; VS_0697; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY THILKENALVEGVDLSFLNFIAFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVTRDYNFAESVVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: vsp:VS_0697

STRING: 575788.VS_0697

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the composition and basic function of Na(+)-translocating NADH-quinone reductase in Vibrio species?

Na+-NQR is a multisubunit membrane protein complex that functions as a primary sodium pump in the respiratory chain of many marine and pathogenic bacteria, including Vibrio species. The enzyme catalyzes the oxidation of NADH and reduction of quinone while translocating sodium ions across the cytoplasmic membrane. Typically in Vibrio species, the Na+-NQR complex consists of six subunits (NqrA-F) and contains multiple cofactors including a 2Fe-2S cluster and four flavin molecules . The enzyme serves as an alternative to the proton-pumping Complex I found in most other bacteria and mitochondria, allowing these organisms to utilize sodium motive force instead of proton motive force for energy conservation .

What are the known structural features of subunit E in the Na+-NQR complex?

Based on studies of Na+-NQR from various Vibrio species, the enzyme complex contains multiple subunits with distinct structural and functional properties. While the available search results don't specifically describe subunit E of V. splendidus Na+-NQR, comparative studies from related species provide insights. The NqrF subunit (which may have functional similarity to subunit E) contains both a flavin domain with FAD and an iron-sulfur domain with a 2Fe-2S cluster . These domains are positioned in close proximity to facilitate electron transfer from NADH → FAD → [2Fe-2S] . Researchers working with recombinant subunit E should consider these potential structural features when designing expression constructs and functional assays.

What expression systems are most effective for recombinant production of Na+-NQR subunits from Vibrio species?

Several expression systems have been successfully used for Na+-NQR subunits from various Vibrio species. For the NqrF subunit from V. cholerae, both homologous expression in V. cholerae itself and heterologous expression in E. coli have proven effective . When expressing membrane proteins or their domains, researchers should consider creating soluble variants by removing transmembrane segments while preserving functional domains. For example, a soluble variant of NqrF (NqrF') and its individual flavin and Fe-S-carrying domains have been successfully produced . For V. alginolyticus, expression of the beta-subunit in E. coli membranes has been reported . When choosing an expression system, consider protein complexity, post-translational modifications, and the presence of cofactors needed for proper folding and function.

What are the critical factors for successful purification of active Na+-NQR subunits?

Purification of active Na+-NQR subunits requires careful consideration of the protein's cofactor requirements and stability. Based on studies with NqrF from V. cholerae, key considerations include:

  • Cofactor retention: Na+-NQR subunits may contain flavins (FAD) and iron-sulfur clusters that can be lost during purification .

  • Detergent selection: For membrane-associated subunits, the choice of detergent is critical for maintaining native conformation and activity.

  • Buffer composition: Sodium concentration may affect stability and conformation of Na+-NQR subunits.

  • Reducing conditions: To prevent oxidative damage to iron-sulfur clusters and flavin cofactors.

For soluble domains like NqrF', conventional purification techniques such as affinity chromatography (e.g., His-tag purification) followed by size exclusion chromatography have proven effective .

How can researchers verify the proper folding and cofactor incorporation in recombinant Na+-NQR subunits?

Verification of proper folding and cofactor incorporation is essential for functional studies of Na+-NQR subunits. Several complementary approaches can be used:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can confirm the presence of flavin cofactors (characteristic peaks at ~370 and ~450 nm) and iron-sulfur clusters .

  • Circular dichroism (CD) spectroscopy: Useful for assessing secondary structure and the environment of Fe-S clusters .

  • Electron paramagnetic resonance (EPR) spectroscopy: Can characterize the properties of iron-sulfur clusters and detect flavin radicals formed during catalysis .

  • Activity assays: Measurement of NADH oxidation activity (reported rates of ~20,000 μmol min⁻¹ mg⁻¹ for V. cholerae NqrF') provides functional verification .

  • Cofactor quantification: Determination of FAD:protein stoichiometry (ideally 1:1 for NqrF) .

A properly folded recombinant NqrF with correct cofactor incorporation should exhibit high NADH oxidation activity and characteristic spectroscopic features.

What methods are most appropriate for assessing the electron transfer activity of recombinant Na+-NQR subunits?

Electron transfer activity of Na+-NQR subunits can be assessed using several complementary approaches:

  • NADH oxidation assays: Monitoring NADH consumption spectrophotometrically at 340 nm provides a direct measure of electron input to the system .

  • Artificial electron acceptor assays: Using electron acceptors like ferricyanide or dichlorophenolindophenol (DCIP) to measure electron transfer from reduced flavins.

  • Quinone reduction assays: Measuring the reduction of physiological or artificial quinones.

  • Stopped-flow spectroscopy: For measuring rapid electron transfer kinetics between cofactors.

  • Redox titrations: To determine the midpoint potentials of the various cofactors.

For the NqrF subunit from V. cholerae, NADH oxidation activity as high as 20,000 μmol min⁻¹ mg⁻¹ has been reported for the recombinant protein .

How can researchers investigate the Na+ translocation function associated with Na+-NQR activity?

Investigation of Na+ translocation requires intact membrane systems or reconstituted proteoliposomes. Several approaches can be used:

  • Na+ electrode measurements: Direct monitoring of Na+ movement using sodium-selective electrodes.

  • Fluorescent Na+ indicators: Such as SBFI (Sodium-Binding Benzofuran Isophthalate) for real-time monitoring of Na+ flux.

  • Radioisotope (²²Na+) flux experiments: For quantitative assessment of sodium transport.

  • Membrane potential measurements: Using voltage-sensitive dyes to monitor the development of membrane potential during enzyme activity.

  • Reconstitution studies: Incorporation of purified Na+-NQR into proteoliposomes for controlled assessment of Na+ pumping.

Importantly, studies with V. cholerae have shown that loss of Na+-NQR does not affect all Na+ pumping-related phenotypes, suggesting that other secondary Na+ pumps can compensate for Na+-NQR activity .

What experimental approaches can identify interactions between subunit E and other components of the Na+-NQR complex?

Several techniques can be employed to study subunit interactions within the Na+-NQR complex:

  • Co-immunoprecipitation (Co-IP): Using antibodies against subunit E to pull down interacting partners.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify proteins in close proximity.

  • Bacterial two-hybrid systems: For detecting protein-protein interactions in vivo.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified subunits.

  • Microscale thermophoresis (MST): To detect interactions between components in solution.

  • Fluorescence resonance energy transfer (FRET): By labeling subunits with appropriate fluorophores to detect proximity and interaction.

These approaches can help establish the functional relationship between subunit E and other components of the Na+-NQR complex, thereby elucidating the molecular mechanisms of electron transfer and Na+ translocation.

What are the most effective techniques for structural characterization of Na+-NQR subunits?

Structural characterization of Na+-NQR subunits can be approached using multiple complementary techniques:

  • X-ray crystallography: The gold standard for high-resolution protein structures, though challenging for membrane proteins. The crystal structure of DβH (Dopamine β-hydroxylase, another enzyme system) reported in 2016 demonstrates the feasibility of this approach for complex enzymes .

  • Cryo-electron microscopy (Cryo-EM): Increasingly powerful for membrane protein complexes without the need for crystallization.

  • Nuclear magnetic resonance (NMR): Suitable for smaller subunits or domains under 30 kDa.

  • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Can reveal dynamic aspects of protein structure and identify regions involved in subunit interactions.

  • Molecular modeling: Homology modeling based on related structures, particularly useful when combined with experimental constraints.

For Na+-NQR subunits specifically, spectroscopic techniques like EPR, visible absorption, and circular dichroism have been successfully used to characterize the electronic structure of cofactors and their protein environment .

How can researchers generate structural models of subunit E in the absence of crystal structures?

In the absence of crystal structures, researchers can employ several approaches to generate structural models of Na+-NQR subunit E:

  • Homology modeling: Using structurally characterized homologous proteins as templates. The NqrF subunit from V. cholerae, which contains both flavin and Fe-S domains, could serve as a potential template for modeling similar domains in subunit E .

  • Ab initio modeling: Using programs like Rosetta or I-TASSER that predict structure based on physicochemical principles and statistical potentials.

  • Integrative modeling: Combining low-resolution experimental data from techniques like SAXS, HDX-MS, or crosslinking with computational modeling.

  • Machine learning approaches: Newer tools like AlphaFold2 can predict protein structures with unprecedented accuracy.

  • Evolutionary coupling analysis: Detecting co-evolving residues that likely interact in the folded structure.

Additionally, functional data like site-directed mutagenesis results can provide constraints for model validation. For example, the observed electron transfer pathway NADH → FAD → [2Fe-2S] in NqrF requires positioning of the FAD and Fe-S cluster in close proximity , providing a functional constraint for structural models.

What insights can spectroscopic techniques provide about the cofactors and active sites in Na+-NQR subunits?

Spectroscopic techniques offer powerful insights into the cofactors and active sites of Na+-NQR subunits:

  • UV-visible absorption spectroscopy: Identifies flavin cofactors and their redox states. For example, the addition of NADH to NqrF' results in the formation of a neutral flavosemiquinone, detectable by its characteristic spectrum .

  • EPR spectroscopy: Characterizes paramagnetic centers including iron-sulfur clusters and flavin radicals. EPR studies have indicated that the Fe-S cluster in NqrF' and its Fe-S domain is related to 2Fe ferredoxins of the vertebrate-type .

  • Circular dichroism spectroscopy: Provides information about protein secondary structure and the environment of chromophores including Fe-S clusters .

  • Resonance Raman spectroscopy: Can probe the vibrational modes of cofactors in their native protein environment.

  • Fluorescence spectroscopy: Useful for studying flavin environments and protein conformational changes.

  • FTIR spectroscopy: Can detect subtle changes in protein structure upon substrate binding or during catalysis.

These techniques collectively provide a comprehensive picture of cofactor properties, redox states, and the structural environment of the active site.

How can genetic engineering be used to enhance the expression or activity of recombinant Na+-NQR subunits?

Several genetic engineering strategies can enhance expression or activity of recombinant Na+-NQR subunits:

  • Codon optimization: Adjusting codon usage to match the expression host can significantly improve protein production levels.

  • Fusion tags: Strategic placement of solubility-enhancing tags (e.g., SUMO, MBP) can improve expression of difficult proteins while maintaining activity.

  • Domain engineering: Creating chimeric constructs or soluble variants by precise domain delineation, as demonstrated with NqrF' from V. cholerae .

  • Site-directed mutagenesis: Targeted mutations can enhance stability, solubility, or activity. For example, engineering of chloroperoxidase (CPO) has achieved improved epoxidation and chlorination activity (up to 20-fold) through random mutagenesis .

  • Directed evolution: Libraries of mutants can be screened for improved properties including expression, stability, and activity.

  • Expression system optimization: Selection of appropriate promoters, signal sequences, and host strains can dramatically improve recombinant protein yields.

When implementing these strategies, researchers should carefully validate that engineered variants maintain native-like properties, particularly with respect to cofactor incorporation and electron transfer capabilities.

What are the potential applications of Na+-NQR research in understanding bacterial bioenergetics and developing antimicrobial strategies?

Na+-NQR research has significant implications for both fundamental and applied science:

  • Bioenergetic diversity: Na+-NQR represents an alternative to the more common H+-translocating respiratory complexes, offering insights into the evolution and diversity of bioenergetic systems .

  • Pathogen physiology: In pathogens like V. cholerae, Na+-NQR significantly influences metabolism and potentially virulence. Transcriptome analysis has revealed that loss of Na+-NQR affects expression of genes involved in acid resistance and sialic acid catabolism .

  • Antimicrobial targets: As a unique bacterial enzyme absent in humans, Na+-NQR represents a potential specific target for antimicrobial development, particularly for Vibrio pathogens.

  • Metabolic engineering: Understanding Na+-dependent bioenergetics could enable engineering of microbes with novel metabolic capabilities.

  • Bioelectrochemical applications: The electron transfer properties of Na+-NQR components could be exploited in bioelectrochemical systems or biosensors.

The understanding gained from studying Na+-NQR in non-pathogenic species like V. splendidus may provide transferable insights applicable to pathogenic Vibrio species where this enzyme plays crucial roles.

How do variations in Na+-NQR subunits across different Vibrio species reflect evolutionary adaptations to different ecological niches?

Comparative analysis of Na+-NQR across Vibrio species provides evolutionary insights:

  • Sequence diversity: Variations in Na+-NQR subunits across Vibrio species likely reflect adaptations to different environmental conditions including salinity, temperature, and energy sources.

  • Cofactor preferences: Adaptations in cofactor binding sites may reflect optimization for different redox potentials or substrate specificities.

  • Sodium dependence: The degree of dependence on sodium motive force versus proton motive force may vary across species reflecting their ecological niche.

  • Regulatory differences: The control of Na+-NQR expression may be integrated with different metabolic circuits across species.

  • Structural variations: Differences in subunit composition or arrangement may reflect functional adaptations.

The study of Na+-NQR from V. splendidus, which occupies marine environments, compared with that from pathogenic species like V. cholerae, could reveal how this enzyme complex has been adapted for different ecological contexts. An analogous case of evolutionary diversification has been observed with the QnrS-like quinolone resistance determinants, where V. splendidus harbors chromosome-encoded variants (QnrVS1 and QnrVS2) sharing 84-88% amino acid identity with plasmid-mediated QnrS determinants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.