Recombinant Vibrio splendidus Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

ParameterDetails
Uniprot IDB7VH11
Protein LengthPartial
Expression HostYeast
Purity>85% (SDS-PAGE)
Alternative NamesHeat shock protein HtpX
EC Classification3.4.24.- (metalloprotease)
AA Sequence (Partial)MKRVmLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGSFISLMMSKK...

Key Features:

  • Function: Categorized as a heat shock protein with potential proteolytic activity, though specific substrates remain uncharacterized.

  • Structure: Contains domains characteristic of metalloproteases, including a conserved catalytic site requiring zinc ions .

  • Thermal Stability: Optimal storage at -20°C/-80°C for liquid (6 months) and lyophilized forms (12 months) .

  • Tagging: Tag type determined during manufacturing; no tag-specific data is publicly available.

  • Quality Control: SDS-PAGE validation ensures >85% purity, with no reported contaminants .

Research Context and Gaps

While HtpX shares structural and functional similarities with other Vibrio metalloproteases (e.g., Vsm), no direct studies have been published on its enzymatic activity or role in pathogenicity. Current research focuses on:

Related ProteinsKey Findings
Vsm (Vibrio splendidus Metalloprotease)- Major virulence factor in V. splendidus LGP32 .
- Cleaved by PepT-like peptidase (PepTL) at low temperatures .
- Toxicity confirmed via cell culture and animal models .
HppDV.s.- Hemolysin with dual roles in survival and cytotoxicity .
- Regulates global metabolic pathways in V. splendidus .

Critical Gaps:

  1. Functional Annotation: HtpX’s catalytic targets and biological role remain undefined.

  2. Pathogenicity Link: No evidence ties HtpX directly to virulence in V. splendidus or other hosts.

  3. Regulation: Expression patterns and environmental triggers (e.g., temperature, stress) are unexplored.

Potential Applications

ApplicationRationale
Structural BiologyStudy metalloprotease catalytic mechanisms and domain interactions.
Pathogen ResearchCompare HtpX with Vsm to identify conserved virulence strategies.
BiotechnologyExplore biocatalytic potential in peptide processing or biofilm degradation.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure a specific tag type, please inform us, and we will prioritize its development.
Synonyms
htpX; VS_2035; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Target Names
htpX
Target Protein Sequence
MKRVMLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGSFISLMMSKK MALRSVGGMVIESPRNETEHWLMETVSRQSQQVGIGMPTVAIYDSPDINAFATGAKRNDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS NDNEEEGGSNMMVYFGVSMVLELVFGFLASFITMWYSRHREFHADADAAHLVGKEKMIAA LERLKVSHEPQLEGSMMAFGINGKKSLTELLMSHPPLDKRIASLRNM
Uniprot No.

Target Background

Database Links

KEGG: vsp:VS_2035

STRING: 575788.VS_2035

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Vibrio splendidus Protease HtpX and how does it function in bacterial cells?

HtpX is a membrane-bound zinc metalloprotease that participates in protein quality control within Vibrio splendidus. It belongs to the M50 family of metalloproteases and contains multiple transmembrane domains with a conserved HExxH motif in its catalytic domain. HtpX primarily functions to degrade misfolded or damaged membrane proteins, particularly under stress conditions, helping the bacterium maintain membrane homeostasis.

Methodological approach: To study HtpX function, researchers should employ gene deletion strategies similar to those described for other Vibrio proteases . Complementation assays using wild-type and catalytically inactive mutants can confirm phenotypes. Proteomics approaches comparing wild-type and htpX-deletion strains can identify accumulated substrate proteins and provide insights into the enzyme's physiological role.

How does HtpX differ from other metalloproteases in Vibrio species?

Unlike secreted metalloproteases such as Vsm that function primarily in virulence and environmental adaptation , HtpX is membrane-anchored and functions in intracellular protein quality control. While Vsm requires processing by other proteases for activation as shown in V. splendidus strain JZ6 , HtpX typically functions autonomously within the membrane. Additionally, their substrate specificities differ significantly: Vsm targets extracellular host proteins, whereas HtpX primarily targets misfolded membrane proteins within the bacterial cell.

Methodological approach: Comparative biochemical characterization of purified proteases using diverse synthetic substrates, combined with structural analysis, provides the clearest distinction between different Vibrio metalloproteases.

What are the optimal conditions for studying HtpX activity in vitro?

The optimal conditions for studying HtpX activity reflect both its biochemical requirements and the natural environment of Vibrio splendidus:

ParameterOptimal RangeConsiderations
Temperature15-25°CReflects marine environment of V. splendidus
pH7.0-8.0Marine pH range
Salt (NaCl)0.5-3.0%V. splendidus is halophilic, requiring salt for growth
Metal ions0.1-1.0 mM Zn²⁺Essential cofactor for metalloprotease activity
DetergentsDDM, LMNG at 2-3× CMCRequired to maintain membrane protein solubility
Reducing agents1-5 mM DTTMaintains cysteine residues in reduced state

Methodological approach: Systematic optimization using factorial design experiments that test multiple parameters simultaneously helps identify true optima rather than local maxima.

What expression systems yield functional recombinant HtpX for biochemical studies?

The expression of membrane-bound metalloproteases like HtpX presents significant challenges requiring specialized approaches:

Expression SystemAdvantagesLimitationsYield
E. coli C41/C43Specialized for membrane proteinsLower expression than standard strains0.5-2 mg/L
E. coli with pBAD vectorTunable expression levelsRequires careful optimization1-3 mg/L
Cold-shock expression (16°C)Improved foldingExtended cultivation time0.5-1.5 mg/L
Insect cells (baculovirus)Better membrane protein foldingHigher cost, complex protocols2-5 mg/L
Cell-free systemsAvoids toxicity issuesExpensive, limited scale0.1-0.5 mg/reaction

Methodological approach: Construct expression vectors with N-terminal fusion tags (His₁₀, MBP, or SUMO) to facilitate detection and purification. Optimize induction conditions (inducer concentration, temperature, duration) for each system to balance yield and proper folding.

What purification strategy yields the highest activity of recombinant HtpX?

A multi-step purification strategy optimized for membrane metalloproteases typically includes:

  • Membrane fractionation through differential centrifugation

  • Solubilization using mild detergents (preferably DDM or LMNG)

  • Immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography to ensure homogeneity

Each step must be optimized to maintain enzyme activity:

Purification StepCritical ParametersActivity Retention (%)
Membrane extractionGentle disruption methods80-90
Detergent solubilizationLMNG at 1% (w/v) for 1h at 4°C70-80
IMAC purificationLow imidazole in wash buffers (10-30 mM)60-70
Size exclusionAddition of 10% glycerol as stabilizer90-95

Methodological approach: Assess enzyme activity after each purification step to identify critical points of activity loss. Include zinc ions (0.1 mM ZnCl₂) in all buffers to maintain the metalloprotease active site integrity .

What are the most sensitive methods for measuring HtpX proteolytic activity?

Several complementary approaches provide comprehensive assessment of HtpX activity:

Assay MethodDetection LimitAdvantagesLimitations
FRET peptide substrates0.1-1 nM enzymeReal-time kinetics, high sensitivityRequires knowledge of cleavage specificity
SDS-PAGE with model substrates5-10 nM enzymeVisual confirmation of cleavageSemi-quantitative, endpoint measurement
Mass spectrometry1-5 nM enzymeIdentifies exact cleavage sitesRequires specialized equipment
Circular dichroism50-100 nM enzymeMonitors structural changesLower sensitivity
Isothermal titration calorimetry100-500 nM enzymeProvides binding and catalytic parametersRequires significant protein amounts

Methodological approach: Begin with FRET-based assays using commercially available peptide libraries to identify potential substrates, followed by validation with more specific assays to determine precise cleavage mechanisms.

How does temperature affect HtpX activity and stability in Vibrio splendidus?

As V. splendidus is a marine bacterium adapted to moderate temperatures, HtpX activity shows temperature dependence reflecting its ecological niche:

Temperature (°C)Relative Activity (%)Stability (t₁/₂, hours)V. splendidus Physiology
420-30>72Minimal growth
1560-8024-48Optimal growth for many marine isolates
2090-10012-24Typical laboratory growth temperature
2580-906-12Upper range of natural habitat temperature
3060-702-6Heat stress begins
3730-400.5-2Significant heat stress for marine Vibrio

Methodological approach: Measure initial reaction rates at various temperatures using standardized substrate concentrations, while conducting parallel stability studies to distinguish between temperature effects on catalytic rate versus enzyme denaturation.

How does HtpX contribute to Vibrio splendidus stress response mechanisms?

HtpX plays critical roles in bacterial stress response through several mechanisms:

  • Degradation of misfolded membrane proteins that accumulate during stress conditions

  • Maintenance of membrane integrity under temperature, osmotic, or oxidative stress

  • Integration with other proteases in comprehensive protein quality control networks

  • Processing of specific stress-related substrates that may influence signaling pathways

Methodological approach: Create htpX deletion mutants and assess their survival under various stress conditions (temperature shifts, oxidative agents, membrane-disrupting compounds). Complementation with wild-type htpX should restore stress tolerance, while catalytically inactive variants would not.

What is the relationship between HtpX activity and Vibrio splendidus virulence?

While specific information about HtpX's role in V. splendidus virulence remains limited, evidence from other Vibrio proteases suggests potential contributions:

Potential MechanismExperimental ApproachExpected Results
Stress tolerance during host infectionInfection models with wild-type vs. ΔhtpXReduced colonization by mutant
Processing of virulence factorsProteomics comparing secreted proteinsAltered processing patterns
Surface protein modificationFlow cytometry with surface markersChanged surface antigen presentation
Biofilm formationCrystal violet assaysAltered biofilm structure or stability

Methodological approach: Compare wild-type and htpX mutant strains in virulence models, while identifying potential virulence-related substrates through comparative proteomics approaches .

How does quorum sensing affect HtpX expression and activity?

Quorum sensing (QS) likely regulates HtpX expression as part of the broader stress response network in Vibrio species:

  • In V. harveyi, QS regulates expression of various proteases including metalloproteases

  • QS systems respond to changes in cell density and environmental conditions

  • The three-channel QS system described in Vibrio species integrates multiple signals that may influence htpX expression

Methodological approach: Quantitative RT-PCR (similar to methods described in ) comparing htpX expression in wild-type and QS mutant strains at different cell densities. Reporter gene fusions (htpX promoter driving luciferase) can provide real-time monitoring of expression in response to autoinducers.

How can CRISPR-Cas9 technology be applied to study HtpX function in Vibrio splendidus?

CRISPR-Cas9 offers several advantages for studying HtpX function:

ApplicationMethodologyExpected Outcome
Gene deletionTargeting htpX coding sequenceComplete loss-of-function phenotype
Point mutationsHDR-mediated modification of catalytic residuesSeparation of catalytic vs. structural roles
Domain mappingPrecise truncations or internal deletionsIdentification of functional domains
Protein taggingC-terminal fluorescent protein fusionLocalization studies in live cells
CRISPRidCas9 targeting htpX promoterTunable repression for dosage studies

Methodological approach: Design guide RNAs targeting conserved regions of htpX, optimize transformation protocols for V. splendidus, and develop appropriate selection strategies for identifying successful edits.

What proteomics approaches best identify the in vivo substrates of HtpX?

Several complementary proteomics approaches can identify physiological HtpX substrates:

ApproachPrincipleAdvantagesChallenges
Comparative proteomicsCompare WT vs. ΔhtpXIdentifies accumulated substratesIndirect identification
TAILS (Terminal Amine Isotopic Labeling)Enriches for N-termini generated by proteolysisDirect identification of cleavage sitesTechnical complexity
Stable isotope labelingMetabolic labeling combined with immunoprecipitationQuantitative comparisonRequires efficient labeling
Proximity labelingHtpX-BioID fusion labels nearby proteinsIdentifies transient interactionsPotential false positives
Global protein stability profilingPulse-chase with stability measurementsIdentifies proteins with altered half-livesLabor intensive

Methodological approach: Integrate multiple datasets for highest confidence in substrate identification, focusing on proteins that show evidence of HtpX-dependent processing across multiple techniques.

How can molecular dynamics simulations enhance understanding of HtpX catalytic mechanism?

Molecular dynamics simulations provide insights into aspects of HtpX function difficult to study experimentally:

  • Modeling enzyme-substrate interactions in a membrane environment

  • Investigating conformational changes during catalysis

  • Simulating water accessibility to the active site within the membrane

  • Predicting effects of mutations on structure and function

  • Testing hypotheses about zinc coordination and the reaction mechanism

Methodological approach: Create a homology model based on related metalloproteases, embed it in a lipidic bilayer simulation system, and perform extended simulations (>100 ns) to observe relevant conformational dynamics. Validate computational predictions through site-directed mutagenesis and activity assays.

What controls are essential when studying recombinant HtpX activity?

Rigorous control experiments are critical for reliable HtpX research:

Control TypePurposeImplementation
Negative enzyme controlEstablish baseline activityHeat-inactivated enzyme preparation
Catalytic site mutantConfirm specificity of observed activityH→A mutations in HExxH motif
Metal chelationVerify metalloprotease mechanismEDTA treatment (reversible by Zn²⁺)
Substrate specificityConfirm cleavage site requirementsMutated substrates at predicted cleavage sites
Related proteaseDistinguish HtpX-specific effectsPurified Vsm or other Vibrio proteases
Inhibitor panelClassify protease mechanismTest against serine, cysteine, and metalloprotease inhibitors

Methodological approach: Include all relevant controls in parallel with experimental samples, ensuring identical buffer conditions and incubation times to minimize variability.

How should conflicting or unexpected results in HtpX research be interpreted?

When faced with contradictory data, systematic troubleshooting approaches include:

  • Verify enzyme integrity through activity assays and SDS-PAGE before each experiment

  • Ensure metal cofactor availability by adding fresh ZnCl₂ to reaction buffers

  • Check for interfering contaminants that may co-purify with the recombinant protein

  • Test for detergent effects on activity and substrate accessibility

  • Consider temperature-dependent effects on both enzyme activity and stability

  • Evaluate buffer components for potential inhibitory effects

Methodological approach: Design experiments with internal controls that can identify sources of variability. When contradictory results persist, consider that they may reflect genuine biological complexity rather than technical artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.