Recombinant Vibrio splendidus Universal stress protein B homolog (uspB)

What is Vibrio splendidus Universal stress protein B homolog and what is its significance in bacterial physiology?

Vibrio splendidus Universal stress protein B homolog (uspB) is a stress-response protein expressed by the marine pathogen Vibrio splendidus. Universal stress proteins (USPs) function as cellular sensors and response elements during environmental stress conditions. The uspB homolog in V. splendidus (strain LGP32) is encoded by the uspB gene (locus name VS_0092) and plays a critical role in bacterial adaptation to adverse environmental conditions . USPs are widely implicated in stress tolerance, virulence, and survival mechanisms in pathogenic bacteria, making uspB a significant target for understanding V. splendidus pathogenicity in marine organisms including Apostichopus japonicus, Atlantic salmon, and Crassostrea gigas . The protein belongs to a larger family of universal stress proteins that contribute to bacterial adaptability and resilience against various environmental stressors.

How does uspB differ from other universal stress proteins in Vibrio species?

The Universal stress protein B homolog (uspB) in V. splendidus has a distinct amino acid sequence compared to other USPs, with a full-length protein of 107 amino acids. The amino acid sequence (MISGDTILFALMVVTCVNWARYFTALRTLIYIMREAHPLLYQQVDGGGFFTTHGNMTKQVRLFSYIKSKEYHHHHDEVFTSKCDRVRQLFILSSALLGVTLLSSFIV) contains structural motifs unique to this specific protein . Unlike some other bacterial systems where multiple USPs may function in operons, V. splendidus uspB likely functions independently, similar to what has been observed in Edwardsiella ictaluri where thirteen USPs were identified scattered throughout the chromosome without operon structure . The primary sequence and structural characteristics of uspB contribute to its specific functional properties in stress response and potentially in virulence mechanisms.

What stress conditions trigger uspB expression in Vibrio splendidus?

Based on comparative studies with other universal stress proteins, V. splendidus uspB expression is likely triggered by multiple stress conditions including nutrient limitation, oxidative stress, temperature fluctuations, osmotic stress, and host-associated stressors. Research on other bacterial USPs has shown that these proteins are significantly upregulated during acid stress, oxidative stress, and when bacteria encounter host defense mechanisms . In particular, related USPs like USP07 in E. ictaluri show very high expression levels after host stress exposure . For V. splendidus, which inhabits marine environments and infects various marine organisms, uspB expression may be particularly responsive to changes in salinity, temperature, and host-derived antimicrobial compounds. Experimental studies tracking uspB expression under controlled stress conditions would be necessary to fully characterize its specific expression triggers.

What are the key structural domains of uspB and how do they relate to its function?

The recombinant V. splendidus uspB protein consists of 107 amino acids with an expression region spanning positions 1-107 . While the search results don't provide the complete domain structure, USPs typically contain at least one USP domain with a conserved nucleotide-binding motif. Based on studies of other USPs, the structure likely includes β-strands forming a β-sheet core surrounded by α-helices. The protein may contain ATP-binding sites that influence its functional activities. The specific arrangement of hydrophobic and hydrophilic residues in uspB (MISGDTILFALMVVTCVNWARYFTALRTLIYIMREAHPLLYQQVDGGGFFTTHGNMTKQVRLFSYIKSKEYHHHHDEVFTSKCDRVRQLFILSSALLGVTLLSSFIV) suggests membrane association capabilities, potentially allowing it to interact with cellular membranes during stress response . The structural features enable uspB to function in signal transduction and stress adaptation, although the specific mechanisms remain to be fully characterized for V. splendidus uspB specifically.

How does the ATP-binding capacity of uspB contribute to its stress response function?

While the search results don't specifically mention ATP-binding capacity of V. splendidus uspB, many universal stress proteins are known to bind ATP, which modulates their activity and function. Based on research on related USPs, ATP binding likely induces conformational changes in uspB that alter its interactions with other cellular components. This nucleotide-binding capacity may enable uspB to function as an energy-sensing switch that can trigger downstream stress response pathways when cellular energy levels are compromised during stress conditions. The ATP-binding and potential ATPase activity could also contribute to chaperone-like functions, helping to stabilize proteins under stress conditions. In other bacterial USPs, ATP binding has been shown to facilitate dimerization or oligomerization, which may be essential for certain signaling functions. Experimental verification of ATP binding through techniques such as isothermal titration calorimetry (ITC) or fluorescence-based assays would be necessary to confirm this function in V. splendidus uspB specifically.

What are the optimal conditions for expression and purification of recombinant V. splendidus uspB?

For optimal expression and purification of recombinant V. splendidus uspB, researchers should consider the following protocol guidelines:

Expression System: Based on commercial recombinant protein production practices, E. coli expression systems with T7 promoter-based vectors are typically effective for uspB expression. BL21(DE3) or Rosetta strains are recommended for potentially improved expression of proteins with rare codons.

Culture Conditions:

• Growth medium: LB or 2xYT supplemented with appropriate antibiotics

• Induction: 0.5-1.0 mM IPTG when culture reaches OD600 of 0.6-0.8

• Post-induction growth: 16-18°C for 16-20 hours (to minimize inclusion body formation)

Purification Strategy:

• Cell lysis using sonication or pressure-based disruption in Tris-based buffer (pH 7.5-8.0)

• Initial purification via affinity chromatography (His-tag or other fusion tags)

• Secondary purification using ion-exchange or size-exclusion chromatography

• Final buffer formulation containing 50% glycerol for stability

Storage Conditions: Store the purified protein at -20°C for short-term use or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity .

What are the most effective methods for studying uspB-protein interactions in vitro?

To effectively study uspB-protein interactions in vitro, researchers should consider multiple complementary techniques:

Pull-down Assays: Using tagged recombinant uspB as bait to identify interacting proteins from cell lysates. The recombinant V. splendidus uspB can be immobilized on affinity matrix via its tag, followed by incubation with bacterial lysate under various stress conditions to identify condition-specific interacting partners.

Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics and affinity between uspB and candidate interacting proteins. This technique provides real-time measurements of association and dissociation rates.

Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding interactions, providing insights into binding mechanisms and energetics.

Yeast Two-Hybrid (Y2H) or Bacterial Two-Hybrid Systems: For screening potential interacting partners before verification with more rigorous biochemical methods.

Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis can identify transient or weak interactions that might be missed by other techniques.

Co-immunoprecipitation (Co-IP): If antibodies against uspB are available, Co-IP can be used to pull down native protein complexes from V. splendidus under different stress conditions.

These methods should be coupled with proper controls, including non-stress conditions and unrelated proteins, to validate the specificity of identified interactions.

How can researchers effectively measure the expression levels of uspB in response to various stressors?

To effectively measure uspB expression levels in response to various stressors, researchers should employ multiple complementary approaches:

Quantitative RT-PCR (qRT-PCR):

• Design primers specific to the uspB gene (locus VS_0092) in V. splendidus

• Extract RNA from bacterial cultures exposed to different stressors (acid, oxidative, osmotic stress, host factors)

• Perform reverse transcription followed by qPCR

• Normalize expression to stable reference genes (validated housekeeping genes for V. splendidus)

Western Blotting:

• Generate antibodies against recombinant uspB or use epitope tags

• Extract proteins from stressed bacteria under non-denaturing conditions

• Perform SDS-PAGE followed by immunoblotting

• Quantify band intensity relative to total protein or housekeeping proteins

Reporter Gene Assays:

• Construct transcriptional fusions between the uspB promoter and reporter genes (GFP, luciferase)

• Integrate constructs into V. splendidus or use compatible plasmids

• Measure reporter activity under various stress conditions

• Correlate reporter signal with stress intensity and duration

RNA-Seq Analysis:
For global transcriptional profiling to contextualize uspB expression within broader stress response networks.

Experimental Design Considerations:

• Include time-course analyses to capture temporal dynamics of expression

• Test multiple stress intensities to establish dose-response relationships

• Include recovery phases to assess expression during stress adaptation

• Compare wild-type strains with relevant mutants to identify regulatory pathways

This multi-method approach provides comprehensive data on both transcriptional and translational regulation of uspB under stress conditions.

How does uspB contribute to V. splendidus virulence in marine host organisms?

While the search results don't provide direct evidence for V. splendidus uspB's role in virulence, comparative analysis with other bacterial USPs suggests potential virulence-related functions. Universal stress proteins in other bacterial pathogens have been demonstrated to contribute significantly to virulence mechanisms . For example, in Edwardsiella ictaluri, USP07 significantly affects pathogen virulence, with mutants showing decreased mortality in infection models .

For V. splendidus uspB, potential virulence contributions may include:

• Stress Adaptation in Host Environments: Enhancing bacterial survival against host-derived antimicrobial compounds, oxidative burst from immune cells, and acidic environments within phagocytes.

• Biofilm Formation: Possible role in biofilm development that protects bacteria against host defenses and antimicrobials, similar to how phage treatment affects V. splendidus biofilm formation .

• Regulation of Virulence Factors: USPs may act as stress-sensing regulators that coordinate expression of virulence factors in response to host-associated stress signals.

• Metabolic Adaptation: Facilitating metabolic shifts necessary for growth in nutrient-restricted host environments.

• Host Immune Modulation: Potential interference with host immune signaling pathways.

To definitively establish uspB's role in virulence, experimental approaches should include:

• Creation of uspB knockout mutants in V. splendidus

• Virulence assessment in relevant marine animal models (e.g., oysters, sea cucumbers)

• Transcriptomic and proteomic comparison of wild-type and ΔuspB mutants during infection

• Quantification of bacterial survival within host immune cells

What potential exists for targeting uspB in antimicrobial development against V. splendidus infections?

The potential for targeting uspB in antimicrobial development against V. splendidus infections is significant based on several factors:

• Stress Response Disruption: Inhibiting uspB function could potentially impair V. splendidus adaptation to stress conditions encountered during infection, making the bacteria more susceptible to host defenses and conventional antimicrobials.

• Virulence Attenuation: If uspB contributes to virulence as suggested by studies of other USPs , inhibitors could reduce pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance development.

• Novel Target Advantage: As a stress response protein rather than a traditional antibiotic target, uspB inhibitors may face less cross-resistance with existing antimicrobials.

• Phage Therapy Complementation: The effectiveness of phage therapy against V. splendidus biofilms suggests that combining uspB inhibitors with phage treatment could yield synergistic effects, particularly if uspB is involved in biofilm formation or maintenance.

• Marine Environment Considerations: Antimicrobials targeting stress response in V. splendidus might be particularly useful in aquaculture settings where environmental stress factors could be manipulated alongside treatment.

Research strategies should include:

• High-throughput screening for small molecule inhibitors of uspB activity

• Structure-based drug design utilizing the defined amino acid sequence

• Peptide inhibitors designed to disrupt potential protein-protein interactions

• Assessment of combined therapies with phages like vB_VspM_VS1

• Development of delivery systems appropriate for aquaculture applications

The specialized nature of uspB and its potential role in both stress response and virulence make it a promising target for next-generation antimicrobial approaches against V. splendidus.

How can recombinant uspB be utilized in developing diagnostic tools for V. splendidus infections?

Recombinant V. splendidus uspB offers multiple avenues for developing sensitive and specific diagnostic tools for detecting V. splendidus infections in marine organisms:

ELISA-Based Detection Systems:
The commercially available recombinant uspB can be utilized to develop:

• Antibody-based detection systems where anti-uspB antibodies capture V. splendidus from clinical samples

• Competitive ELISA assays where recombinant uspB competes with native protein for antibody binding

• Indirect ELISA methods to detect anti-uspB antibodies in host serum as evidence of infection

Molecular Beacon Probes:
Design of nucleic acid probes targeting the uspB gene (VS_0092) for real-time PCR or isothermal amplification methods, enabling rapid detection from tissue samples or water.

Aptamer-Based Biosensors:
Selection of DNA/RNA aptamers with high affinity for uspB protein, which can be incorporated into:

• Electrochemical biosensors for field testing

• Fluorescence-based detection systems

• Lateral flow assays for point-of-care diagnostics in aquaculture settings

Immunochromatographic Test Strips:
Development of rapid test strips using anti-uspB antibodies conjugated to colored particles for visual detection of V. splendidus in clinical specimens.

Multiplex Detection Systems:
Integration of uspB detection with other V. splendidus markers to improve diagnostic specificity and distinguish between pathogenic and non-pathogenic strains.

The recombinant protein's defined sequence and availability make it an excellent candidate for generating highly specific detection tools. Validation should include:

• Testing against related Vibrio species to confirm specificity

• Determining detection limits in various sample types

• Assessing performance in field conditions relevant to aquaculture

• Comparison with established culture-based methods for sensitivity and specificity

What are the primary challenges in differentiating the functions of uspB from other stress proteins in V. splendidus?

Differentiating the specific functions of uspB from other stress proteins in V. splendidus presents several significant challenges:

Functional Redundancy: USPs often show functional overlap, making it difficult to attribute specific phenotypes to individual proteins. As seen in Edwardsiella ictaluri where 13 USPs were identified , multiple stress proteins may compensate for each other when one is deleted or inhibited.

Context-Dependent Activities: The function of uspB likely varies depending on the specific stress condition, growth phase, and environmental context, requiring comprehensive testing across multiple conditions to fully characterize its role.

Protein-Protein Interaction Networks: USPs typically function within complex interaction networks. Identifying the specific interaction partners of uspB versus other stress proteins requires sophisticated protein interaction studies.

Post-Translational Modifications: Potential modifications of uspB under different conditions may alter its function in ways that are difficult to predict from sequence analysis alone.

Technical Challenges in Gene Deletion: Creating clean gene deletions without polar effects on downstream genes can be technically challenging in marine Vibrio species.

Methodological Approaches to Address These Challenges:

• Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data to create comprehensive maps of stress response networks.

• Conditional Gene Expression Systems: Developing tightly controlled inducible systems for V. splendidus to study uspB function without compensation from other genes.

• Domain Swapping Experiments: Creating chimeric proteins between uspB and other USPs to identify functional domains.

• Single-Cell Analysis: Implementing technologies that can detect cell-to-cell variation in uspB expression and function.

• Temporal Resolution Studies: Developing methods to track uspB activity in real-time during stress response.

These approaches collectively would help delineate the specific contributions of uspB to stress response separate from other stress proteins in V. splendidus.

How do variations in V. splendidus uspB across different strains impact functional characteristics?

The functional impact of strain-specific variations in V. splendidus uspB represents an important area for research:

Observed Variation Patterns:
While the search results don't explicitly detail strain variations in uspB, they do indicate that V. splendidus has multiple strains including LGP32 (isolated from oysters) and 12B01 (isolated from seawater) . Based on patterns observed in other bacterial species, these environmentally distinct strains likely exhibit sequence variations in stress response proteins like uspB.

Potential Functional Impacts of Strain Variations:

• Host Adaptation: Variations in uspB sequence may reflect adaptation to different host organisms. Strains isolated from oysters (LGP32) might express uspB variants optimized for surviving within bivalve immune environments, while environmental isolates (12B01) might have variants better suited for persistence in marine waters.

• Stress Response Specificity: Amino acid substitutions could alter the specificity of stress detection or response mechanisms, with some variants responding more sensitively to particular stressors (temperature, salinity, pH, antimicrobials).

• Virulence Correlation: Specific uspB variants may correlate with enhanced virulence in certain hosts, similar to how USP07 influences virulence in E. ictaluri .

• Protein-Protein Interaction Differences: Variations might affect interaction patterns with other cellular components, altering downstream signaling pathways.

Research Methodology to Address This Question:

This comprehensive approach would elucidate how natural variations in uspB contribute to V. splendidus ecological adaptation and pathogenic potential.

What emerging technologies could advance our understanding of uspB function in bacterial stress response networks?

Several cutting-edge technologies hold promise for deepening our understanding of uspB function within V. splendidus stress response networks:

CRISPR-Cas9 Genome Editing:
Precise genome modification techniques can create targeted uspB mutations, insertions of reporter tags, or regulatable expression systems directly in V. splendidus. This allows for:

• Creation of point mutations to investigate specific functional residues

• Integration of fluorescent tags for real-time protein localization

• Development of conditional knockdown systems for temporal function studies

Single-Cell Transcriptomics:
Applying single-cell RNA-seq to bacterial populations under stress can reveal cell-to-cell variability in uspB expression and identify potential subpopulations with distinct stress response profiles. This technology can capture heterogeneous responses that would be masked in bulk population studies.

Proximity Labeling Proteomics:
Techniques like APEX2 or BioID fused to uspB can identify proximal proteins in living cells under various stress conditions, mapping the dynamic interaction network of uspB during stress response with spatial and temporal resolution.

Cryo-Electron Microscopy:
Advanced structural determination of uspB and its complexes at near-atomic resolution can reveal conformational changes during stress response and provide insights into interaction mechanisms with other cellular components.

Microfluidic Systems:
Microfluidic devices coupled with time-lapse microscopy can monitor single-cell responses to precisely controlled stress gradients, revealing the dynamics of uspB-mediated stress adaptation at unprecedented resolution.

Synthetic Biology Approaches:
Reconstitution of minimal stress response systems incorporating uspB in synthetic cells or cell-free systems can define the sufficient components for functional stress response networks.

In Vivo Biosensors:
Development of FRET-based or split-protein biosensors to monitor uspB conformational changes or interactions in real-time within living bacteria under stress conditions.

Metabolic Flux Analysis: Integration of uspB function with metabolic adaptation during stress through stable isotope labeling and metabolic flux analysis can connect stress response to metabolic reprogramming.