Recombinant Vibrio splendidus UPF0208 membrane protein VS_0999 (VS_0999)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Vibrio splendidus UPF0208 membrane protein VS_0999 (VS_0999) is a protein derived from the bacterium Vibrio splendidus. It belongs to the UPF0208 family of proteins and is characterized as a membrane protein. The "recombinant" aspect indicates that this protein is produced using recombinant DNA technology, typically in a host organism like E. coli .

Basic Information

CategoryDescription
NameRecombinant Vibrio splendidus UPF0208 membrane protein VS_0999 (VS_0999)
Source OrganismVibrio splendidus (strain Mel32 or Vibrio tasmaniensis strain LGP32)
Protein FamilyUPF0208 family
SynonymsVS_0999; UPF0208 membrane protein VS_0999
UniProt IDB7VLV8
Subcellular LocationCell inner membrane; Multi-pass membrane protein
Expression HostE. coli
TagHis-Tag (N-terminal)
Purity>85% as determined by SDS-PAGE
Amino Acid SequenceMSNRVGLASSLKDGQKYMDLWPVRKELNSIFPEQRIIKATRFGVKVMPAIAAISVLTQMVFNNYQAMPQAVVMALFAISLPLQGMWWLGNRSNTKLPPALVSWYRELHEKITETGFALEP MKSRPRYKELAIILNRAFRQLDKSSMERWF

Production and Characteristics

Recombinant VS_0999 is produced in E. coli and often includes an N-terminal His tag to facilitate purification . The protein is stored in a Tris/PBS-based buffer with 6% Trehalose to maintain stability. It is recommended to avoid repeated freeze-thaw cycles and to store the protein at -20°C or -80°C for long-term storage .

Function and Structure

VS_0999 is a member of the UPF0208 protein family, which currently has unknown function. As a multi-pass membrane protein located in the cell's inner membrane, it is likely involved in transport processes, signal transduction, or maintaining membrane integrity.

Potential Applications

As a recombinant protein, VS_0999 can be used in various research applications:

  • Structural Studies: To determine the three-dimensional structure of the protein, which can provide insights into its function.

  • Functional Assays: To investigate the protein's role in Vibrio splendidus, possibly through in vitro assays or by studying the effects of its deletion or overexpression in the organism.

  • Antibody Development: To generate antibodies that specifically target VS_0999, which can be used for detection or therapeutic purposes.

Database Links

  • KEGG: vsp:VS_0999

  • STRING: 575788.VS_0999

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
VS_0999; UPF0208 membrane protein VS_0999
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Target Names
VS_0999
Target Protein Sequence
MSNRVGLASSLKDGQKYMDLWPVRKELNSIFPEQRIIKATRFGVKVMPAIAAISVLTQMV FNNYQAMPQAVVMALFAISLPLQGMWWLGNRSNTKLPPALVSWYRELHEKITETGFALEP MKSRPRYKELAIILNRAFRQLDKSSMERWF
Uniprot No.

Target Background

Database Links

KEGG: vsp:VS_0999

STRING: 575788.VS_0999

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and reconstitution protocols for VS_0999 protein in a research setting?

For optimal stability and experimental reproducibility when working with VS_0999 protein, follow these research-validated protocols:

Storage protocol:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, make working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol (typically to a final concentration of 50%) and store at -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Note that repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided in experimental workflows.

How can I design experiments to investigate the membrane topology of VS_0999?

Investigating the membrane topology of VS_0999 requires a multi-faceted experimental approach:

  • Computational prediction: Begin with topology prediction algorithms (TMHMM, TOPCONS) to identify potential transmembrane segments.

  • Proteolytic digestion mapping: Use techniques like:

    • Limited proteolysis with proteases like trypsin or chymotrypsin on intact cells or spheroplasts

    • Compare digestion patterns using Western blotting with antibodies against different domains or the His tag

  • Cysteine scanning mutagenesis: Systematically replace amino acids with cysteine and use membrane-permeable and impermeable thiol-reactive reagents to determine which residues are accessible from which side of the membrane.

  • Fluorescence-based approaches:

    • GFP-fusion reporter approach, attaching GFP to different positions in the protein

    • FRET analysis between strategically placed fluorophores

  • Structural analysis: For definitive topology determination, techniques like:

    • Cryo-electron microscopy

    • X-ray crystallography if the protein can be solubilized and crystallized

Based on recent advances in membrane protein research, computational design approaches could also be applied to create soluble analogues of VS_0999, which might retain key structural features while being more amenable to structural studies .

What methodologies are most effective for measuring VS_0999 protein-protein interactions in Vibrio splendidus?

To effectively study VS_0999 protein-protein interactions, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express VS_0999 with an epitope tag (His tag is already present)

    • Perform pull-down assays followed by mass spectrometry to identify interacting partners

    • Validate using reciprocal Co-IP with antibodies against identified partners

  • Bacterial two-hybrid system:

    • Adapt bacterial two-hybrid systems for membrane proteins

    • Use split-ubiquitin yeast two-hybrid system specifically designed for membrane proteins

    • Construct a prey library from V. splendidus genomic DNA

  • Crosslinking approaches:

    • Chemical crosslinking with membrane-permeable crosslinkers

    • Photo-crosslinking with photo-activatable amino acid analogues incorporated into VS_0999

    • Analysis of crosslinked complexes by mass spectrometry

  • Fluorescence-based methods:

    • FRET between VS_0999 labeled with one fluorophore and potential partners labeled with another

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence Correlation Spectroscopy (FCS) for dynamic interactions

  • Functional assays:

    • Bacterial growth assays in the presence of antibiotics or stress conditions

    • Virulence assays using cellular models

    • Expression analysis of downstream genes in VS_0999 knockout strains vs. wild-type

When analyzing data, be aware that membrane protein interactions often show high background and may require stringent controls. Comparison of results across multiple methods is strongly recommended.

How can I investigate the role of VS_0999 in Vibrio splendidus pathogenicity and virulence mechanisms?

Investigating VS_0999's role in pathogenicity requires a comprehensive approach combining genetic manipulation, functional assays, and infection models:

  • Gene knockout and complementation:

    • Generate a clean VS_0999 deletion mutant using allelic exchange

    • Create a complemented strain by reintroducing VS_0999 under a native or inducible promoter

    • Develop point mutants targeting key functional residues predicted by structural analysis

  • Virulence assessment in infection models:

    • Challenge appropriate host organisms (e.g., larvae) with wild-type, knockout, and complemented strains

    • Assess mortality rates, tissue damage, and bacterial loads in infected tissues

    • Monitor disease progression through histopathological analysis

Based on previous research with pathogenic V. splendidus strains, the following experimental parameters can be used:

ParameterWild-type strainVS_0999 knockout (hypothetical)Complemented strain
Larval mortality (24h at 10⁶ CFU/mL)79-88%Expected reduction if VS_0999 is involved in virulenceShould restore wild-type levels
Bacterial recovery from infected larvae9.59×10⁴-2.08×10⁵ bacteria/gExpected reductionShould restore wild-type levels
Time to first clinical signs<24 hoursExpected delayShould restore wild-type timing
  • Analysis of virulence factor expression:

    • Compare secretion profiles between wild-type and VS_0999 mutant

    • Measure extracellular enzymatic activities (proteases, hemolysins)

    • Quantify extracellular products (ECPs) and assess their toxicity in cell-free preparations

  • Host response analysis:

    • Measure host immune response markers

    • Evaluate tissue damage markers

    • Assess metabolic changes in host during infection

  • Transcriptomic/proteomic analysis:

    • RNA-seq comparison between wild-type and VS_0999 mutant

    • Proteomic analysis of membrane fractions

    • Identification of differentially regulated pathways

What approaches should be used to explore potential antagonistic relationships between VS_0999 and probiotic Vibrio strains?

To explore antagonistic relationships between VS_0999 and probiotic Vibrio strains, a systematic approach combining molecular, biochemical, and functional analyses is recommended:

  • Growth inhibition assays:

    • Co-culture V. splendidus expressing VS_0999 with potential probiotic Vibrio strains (e.g., Vibrio sp. V33)

    • Measure growth inhibition through OD600 measurements

    • Perform spot assays on solid media to visualize growth inhibition zones

  • Analysis of antagonistic substances:

    • Fractionate cell-free supernatants from probiotic strains:

      • Water-soluble phase vs. organic phase extraction

      • Size fractionation using cutoff methods (e.g., <3 kDa filtrate)

    • Test fractions for inhibitory activity against V. splendidus expressing VS_0999

    • Characterize active fractions by mass spectrometry

  • Proteomic and expression analysis:

    • Analyze differential protein expression in V. splendidus after exposure to probiotic supernatants

    • Focus on VS_0999 expression levels and potential post-translational modifications

    • Monitor expression of iron-uptake-related genes that might be affected (e.g., fur, asbJ, viuB)

  • Real-time RT-PCR monitoring:

    • Design primers targeting VS_0999 and related functional genes

    • Monitor expression changes after exposure to probiotic supernatants

    • Use the comparative threshold cycle method (2^-ΔΔCT) for analysis

Based on previous research on antagonistic relationships between Vibrio strains, consider this experimental setup for real-time RT-PCR:

Time point after exposureGene expression measurementInternal control
10 minutesVS_0999, fur, asbJ, viuB16S rRNA
20 minutesVS_0999, fur, asbJ, viuB16S rRNA
30 minutesVS_0999, fur, asbJ, viuB16S rRNA
  • Promoter analysis:

    • Analyze the promoter region of VS_0999 for transcription factor binding sites

    • Identify potential binding sites for regulators affected by probiotic strains

    • Create reporter gene fusions to monitor promoter activity under different conditions

What are the optimal techniques for protein-protein interaction network mapping of VS_0999 in the bacterial membrane context?

For comprehensive protein-protein interaction (PPI) network mapping of membrane proteins like VS_0999, a multi-method approach addressing the challenges of membrane protein biochemistry is required:

  • Proximity-dependent labeling methods:

    • BioID: Fuse VS_0999 to a promiscuous biotin ligase (BirA*) that biotinylates proximal proteins

    • APEX2: Fuse VS_0999 to an engineered ascorbate peroxidase that catalyzes biotinylation of proximal proteins

    • These methods allow in vivo labeling of interactors in their native membrane environment

  • Membrane-specific interactomics:

    • Detergent-based membrane solubilization optimization

    • Blue-native PAGE coupled with second-dimension SDS-PAGE

    • Gradient centrifugation to isolate membrane protein complexes

  • Crosslinking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers with different spacer arm lengths

    • Analyze crosslinked peptides by LC-MS/MS

    • Apply computational pipelines specific for membrane protein XL-MS data analysis

  • Quantitative interactomics:

    • SILAC or TMT labeling for quantitative comparison of interactomes

    • Compare wild-type vs. VS_0999 mutant strains

    • Statistical analysis to identify high-confidence interactions

  • Computational network integration:

    • Integrate experimental data with genomic context methods

    • Apply Bayesian integration of multiple data types

    • Use machine learning approaches to predict additional interactions

When analyzing interaction data, follow this workflow:

Analysis stepMethodExpected outcome
Primary filteringStatistical significance testingHigh-confidence direct interactors
Network constructionGraph-based algorithmsFunctional modules and complexes
Functional annotationGO enrichment, pathway analysisBiological processes involving VS_0999
ValidationTargeted biochemical assaysConfirmation of key interactions
IntegrationMeta-analysis with published dataPlacement in cellular pathways

This integrated approach helps overcome the challenges of false positives common in membrane protein interaction studies while providing a comprehensive view of VS_0999's functional network.

What experimental design considerations are critical when investigating the effects of VS_0999 expression on bacterial growth and virulence?

When investigating VS_0999's effects on bacterial growth and virulence, a robust experimental design must address several critical factors:

  • Expression system optimization:

    • Evaluate constitutive vs. inducible promoters

    • Titrate expression levels to avoid artifacts from overexpression

    • Confirm proper membrane localization using fractionation and Western blotting

    • Consider native vs. tagged versions and validate tag effects

  • Growth condition variables:

    • Test multiple growth media compositions, particularly varying iron availability

    • Examine growth across different temperatures relevant to host and environmental conditions

    • Assess stationary phase vs. logarithmic phase effects

    • Include various stress conditions (pH, salt concentration, antimicrobial compounds)

  • Statistical design considerations:

    • Use appropriate sample sizes based on power analysis

    • Include biological replicates (minimum n=3) and technical replicates

    • Implement randomization and blinding where possible

    • Use paired experimental designs when comparing isogenic strains

  • Virulence model selection:

    • Choose appropriate infection models based on V. splendidus ecology:

      • Larval challenge assays with relevant host species

      • Cell culture infection models

      • Ex vivo tissue models

    • Consider bacterial inoculum standardization methods:

      • OD-based vs. CFU-based standardization

      • Growth phase standardization

      • Pre-adaptation to host conditions

  • Molecular phenotyping approaches:

    • Transcriptomics (RNA-seq) with appropriate time points

    • Proteomics focused on secreted and membrane fractions

    • Metabolomics to capture small molecule profiles

    • Real-time monitoring using reporter systems

Based on published virulence studies with V. splendidus, consider this experimental design matrix:

Variable factorLevels to testMeasurement endpoints
Bacterial concentration10⁴, 10⁶, and 10⁸ CFU/mLMortality rates at 6, 12, 18, 24, 30, 36, and 48h
Host systemMinimum 3 relevant speciesSpecies-specific clinical signs, bacterial recovery
Growth conditionsStandard, iron-limited, host-mimickingGrowth curves, virulence factor expression
VS_0999 expressionWild-type, knockout, complemented, overexpressedTranscriptional effects, protein levels, phenotypic outcomes

Implement appropriate controls including:

  • Vehicle controls for expression inducers

  • Empty vector controls for recombinant expression

  • Sham operation controls for infection models

  • Measurement of VS_0999 expression levels across all experimental conditions

How can structural modeling approaches be used to predict functional domains and potential ligand binding sites in VS_0999?

For predicting functional domains and binding sites in VS_0999 when experimental structures are unavailable, implement this comprehensive structural bioinformatics workflow:

  • Template-based modeling:

    • Perform sensitive sequence similarity searches using HHpred or HHsearch

    • Identify distant homologs with known structures in the PDB

    • Generate multiple sequence alignments for conservation analysis

    • Create homology models using tools like MODELLER or SWISS-MODEL

    • Validate models using MolProbity, PROCHECK, and QMEAN

  • Ab initio and deep learning approaches:

    • Apply AlphaFold2 or RoseTTAFold for accurate structure prediction

    • Generate multiple models and analyze structural convergence

    • Combine with template-based models for consensus predictions

    • Validate predictions using established metrics (pLDDT scores, PAE plots)

  • Membrane protein-specific considerations:

    • Predict transmembrane regions using TMHMM, TOPCONS, and MEMSAT

    • Apply membrane protein-specific modeling tools like MEMOIR

    • Position models correctly in the membrane using OPM database principles

    • Perform molecular dynamics simulations in explicit membrane environments

  • Functional site prediction:

    • Apply computational solvent mapping to identify potential binding pockets

    • Use ConSurf for evolutionary conservation mapping onto structural models

    • Implement machine learning-based binding site predictors (e.g., DeepSite)

    • Apply molecular docking with fragment libraries to probe binding preferences

  • Integration with experimental data:

    • Correlate structural features with sequence variants in multiple strains

    • Design targeted mutations for experimental validation

    • Use computational models to interpret experimental phenotypes

    • Refine models iteratively based on experimental outcomes

Recent research has demonstrated that deep learning-based approaches can design soluble analogues of membrane proteins while preserving key structural features . This strategy could be applied to VS_0999 to facilitate experimental structural studies while maintaining functionally important domains.

For VS_0999, focus analysis on:

  • Membrane-facing vs. solvent-exposed regions

  • Highly conserved surface patches across related species

  • Potential metal-binding sites

  • Regions with structural similarity to known functional domains in other proteins

Document your structural analysis findings in this format:

Structural featurePrediction methodConfidence scoreSuggested experimental validation
Transmembrane regionsTMHMM, TOPCONS consensusHigh for regions with >90% agreementCysteine scanning mutagenesis
Potential ligand binding siteConSurf + SiteMapMedium (conservation score >7)Site-directed mutagenesis of key residues
Protein-protein interaction interfaceSPPIDER, PrePPILow-MediumCo-immunoprecipitation studies
Functional motifsPROSITE, InterProVariableDeletion or point mutation analysis

What emerging technologies could enhance our understanding of VS_0999's role in bacterial membrane biology?

Emerging technologies offer exciting opportunities to deepen our understanding of VS_0999's role in bacterial membrane biology:

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational changes

    • Single-molecule force spectroscopy to measure binding forces

    • Super-resolution microscopy (PALM/STORM) to visualize VS_0999 organization in native membranes

    • These approaches can reveal dynamic behavior not accessible through bulk measurements

  • Cryo-electron tomography:

    • Visualize VS_0999 in its native membrane environment

    • Map spatial organization relative to other membrane components

    • Capture structural states under different conditions

    • Combine with subtomogram averaging for higher resolution

  • Deep mutational scanning:

    • Create comprehensive libraries of VS_0999 variants

    • Use high-throughput functional assays to assess each variant

    • Map sequence-function relationships at amino acid resolution

    • Identify critical functional residues and tolerant regions

  • Optogenetic approaches:

    • Engineer light-sensitive domains into VS_0999

    • Control protein activity with spatial and temporal precision

    • Study dynamic protein interactions in living cells

    • Monitor downstream signaling events in real-time

  • Integrative structural biology:

    • Combine computational prediction, crosslinking-MS, cryo-EM, and functional data

    • Generate comprehensive structural models across different functional states

    • Map allosteric networks and communication pathways

    • Apply molecular dynamics simulations in realistic membrane environments

  • Synthetic biology approaches:

    • Engineer minimal systems containing only essential components

    • Create orthogonal systems to study VS_0999 function in isolation

    • Design synthetic circuits to probe regulatory connections

    • Develop biosensors based on VS_0999 conformational changes

These emerging approaches could help address key questions about VS_0999, such as its potential roles in signaling, transport, or structural organization of the bacterial membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.