Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126 (VS_0126)
Description
Overview of Recombinant Vibrio splendidus UPF0761 Membrane Protein VS_0126 (VS_0126)
Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126 is a bioengineered protein derived from Vibrio tasmaniensis (formerly classified under Vibrio splendidus). It belongs to the UPF0761 family, a group of proteins with conserved sequences but uncharacterized functions. This protein is expressed recombinantly in microbial or eukaryotic systems, primarily for research purposes in microbiology, structural biology, and vaccine development.
Expression and Purification
VS_0126 is synthesized using recombinant DNA technology, with expression hosts varying by manufacturer:
-
E. coli: Produces full-length or partial proteins with His-tags for affinity purification .
-
Yeast: Used for partial-length proteins, enabling post-translational modifications .
-
Mammalian cells/Baculovirus: Reserved for complex glycosylation or structural studies .
Amino Acid Sequence (Full-Length, 1–313 residues):
MNELPGSYKLKIKKAATGSIQFSRYLLTRMTHDRVNVNAGYLAYITLLSIVPMLTVLLSI LSSFSVFADVGLVIQNFVITNFVPASGDAVHGALLEFVANTGKMTAVGSVFLFIAALMLI SNIDKNLNYIWRVTEKRRAVLSFSMYWMVLTLGPILIGASIAATSYVTSLNLLQNEVVSS AFNTVIRKLPLITSFFAFFGLYLLVPNKKIHFSHAAAGSLVAALLFELSKKGFAAYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEQEQWSDSQEMVHSSDKDKITE QGNNSDSTDPESK .
Functional Inference
While no direct functional data exists for VS_0126, its classification as a UPF0761 membrane protein suggests potential roles in:
-
Membrane Transport: Multi-pass structure implies involvement in ion or solute transport.
-
Pathogen-Host Interaction: As Vibrio splendidus is a marine pathogen, VS_0126 may contribute to virulence or adhesion .
Pathogen Research Context
Though not directly linked to VS_0126, studies on Vibrio splendidus phages (e.g., vB_VspM_VS1) highlight the bacterium’s role in aquaculture diseases. Such research underscores the need for membrane protein studies in understanding pathogen biology .
Product Variants
| Vendor | Product Code | Expression Host | Protein Length | Tag |
|---|---|---|---|---|
| Creative BioMart | RFL18225VF | E. coli | Full-length | His |
| Cusabio | CSB-YP489568VFH1 | Yeast | Partial | Undetermined |
| The Biotek | BT1613574 | Mammalian | Partial | Undetermined |
Limitations
-
Functional Uncertainty: No published studies confirm VS_0126’s biological role.
-
Partial Proteins: Truncated versions may lack critical functional domains .
References
-
Creative BioMart. Recombinant Full Length Vibrio Splendidus Upf0761 Membrane Protein VS_0126 (VS_0126) Protein, His-Tagged.
-
Colorectal Research. ELISA Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126.
-
Cusabio. Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126 (VS_0126), partial.
-
Cusabio. Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126 (VS_0126), partial (Yeast).
-
PLOS ONE. Isolation, characterization and application of a lytic phage vB_VspM_VS1 against Vibrio splendidus.
-
The Biotek. Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126 (VS_0126), partial.
-
Creative BioMart. Symbol Search: vs_0126.
-
Cusabio. Recombinant Vibrio splendidus UPF0761 membrane protein VS_0126 (VS_0126), partial.
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Target Background
KEGG: vsp:VS_0126
STRING: 575788.VS_0126
