Recombinant Vibrio vulnificus Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

Lnt is a membrane-bound enzyme responsible for N-acylating the N-terminal cysteine residue of apolipoproteins, forming triacylated lipoproteins. This modification is critical for proper lipoprotein localization and function in Gram-negative bacteria, including Vibrio vulnificus.

Key Features:

  • Catalytic Triad: Glutamate (Glu), lysine (Lys), and cysteine (Cys) residues form the active site, enabling a two-step ping-pong mechanism:

    1. Thioester Formation: Acyl transfer from phospholipids to the active site Cys.

    2. Acylation Transfer: Acyl group transfer to the apolipoprotein’s cysteine .

  • Structural Dynamics: Conformational changes in Lnt’s "arms" regulate substrate access. Closed and open conformations have been observed, suggesting a gated mechanism for catalysis .

  • Lipid Substrate Interaction: A hydrophobic cleft in the enzyme’s membrane domain facilitates lipid entry to the active site .

Lipoprotein Biogenesis Studies

  • Triacylation Analysis: Lnt’s absence in mutants prevents N-acylation, enabling studies of lipoprotein maturation .

  • Antibiotic Targeting: Essential role of Lnt makes it a candidate for antimicrobial development .

Immunological Studies

  • ELISA Kits: Recombinant Lnt serves as an antigen for detecting anti-Lnt antibodies .

Comparative Analysis of Recombinant Lnt Proteins

SpeciesSourceTagPurityUniProt ID
V. vulnificusE. coliVariable>85%Q7MN04
E. coliE. coliHis>90%Q8XBK2
Photobacterium profundumE. coliHis>90%Q6LNA1

Handling and Stability

  • Storage: Avoid repeated freeze-thaw cycles. Store at -20°C/-80°C .

  • Reconstitution: Use sterile water with 5–50% glycerol for long-term storage .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lnt; VV0913; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-506
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
lnt
Target Protein Sequence
MKNTLFHRLKRPIAAAFVGALTTLAFAPYQIWLVALITPALLLILIHGQSRRQAIWTGYA WGLGQFASGISWVYVSIAGFGGMPLAANLFLMGALIAYLAIYPALFTWSYQRFFAKATLL NLLLAAPALWLIADWLRGWVMTGFPWLWLGYSQIDSPLASFAPIGGVELLTLLLLVGAGA IAYAVIHKRWSMLLIPTVLLSTGYGLSHWDWVTPQPDKTTKVALIQGNVDQNLKWLPSQR WPTIMKYTDLSRENWDADIIIWPEAAIPAFEVELPSYLSNLDSAAKMNQSAIISGIVNQA EDGQFYNSILAVGLTPYGDYSFDLTERYHKHHLLPFGEFVPFESILRPLAPFFNLPMSSF SRGDFVQPNIVANGHPMAPALCYEIIFNEQVRQNVTDDTDFLLTLSNDAWFGRSIGPLQH MEIARMRALELGKPLIRSTNNGLTAVTDHRGKIIASIPQFETAVLRAELTPTQGQTPYHQ LGSWPLYIWVALSLALAWWRKRRTNA
Uniprot No.

Target Background

Function
This recombinant Vibrio vulnificus Apolipoprotein N-acyltransferase (Lnt) catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein; this is the final step in lipoprotein maturation.
Database Links

KEGG: vvy:VV0913

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what is its role in Vibrio vulnificus?

Apolipoprotein N-acyltransferase (lnt) is an enzyme that catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in bacterial lipoprotein maturation . In Vibrio vulnificus, lnt belongs to the CN hydrolase family within the Apolipoprotein N-acyltransferase subfamily . This enzyme is critical for proper lipoprotein processing, which affects bacterial membrane integrity and potentially contributes to pathogenesis mechanisms. The Vibrio vulnificus lnt protein consists of 506 amino acids with a molecular mass of approximately 56.7 kDa . The enzyme's activity ensures appropriate anchoring of lipoproteins to the bacterial membrane, which can influence bacterial survival and virulence expression.

How does the structure of Vibrio vulnificus lnt compare to homologous proteins in other bacterial species?

The Vibrio vulnificus (strain CMCP6) lnt protein shares structural features with other bacterial apolipoprotein N-acyltransferases while maintaining species-specific characteristics. The enzyme contains conserved domains typical of the CN hydrolase family . Vibrio vulnificus lnt exhibits a primary sequence of 506 amino acids with multiple transmembrane domains that anchor it to the bacterial membrane . While the catalytic core regions show conservation across bacterial species, there are variations in specific amino acid sequences that may account for substrate specificity differences. These structural variations are particularly evident in the regions involved in phospholipid binding and recognition of the apolipoprotein substrate, potentially reflecting adaptations to the marine environment inhabited by Vibrio vulnificus .

What expression systems are most effective for producing active recombinant Vibrio vulnificus lnt?

  • Using E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Expression at lower temperatures (16-20°C) to improve proper folding

  • Employing fusion tags such as MBP (maltose-binding protein) to enhance solubility

  • Incorporating specific membrane-mimicking detergents during purification

The addition of phospholipids during the purification process has been shown to improve enzyme stability and activity, as these serve as both substrates and stabilizing agents for the enzyme . For highest activity retention, expression systems that allow for proper membrane integration during synthesis will generally outperform those producing the protein in inclusion bodies requiring refolding.

What are the optimal conditions for assaying Vibrio vulnificus lnt enzymatic activity?

Establishing reliable assay conditions for Vibrio vulnificus lnt activity requires careful consideration of multiple parameters. The optimal enzymatic assay conditions include:

ParameterOptimal RangeNotes
pH7.2-7.8Phosphate buffer preferred
Temperature30-37°CTemperature-dependent activity reflective of V. vulnificus environmental adaptations
Divalent Cations1-5 mM Mg²⁺Enhances catalytic activity
Phospholipid DonorsPE, PG, CLPhosphatidylethanolamine (PE) often preferred
Detergents0.1-0.5% DDM or Triton X-100Critical for maintaining enzyme solubility
Reducing Agents1-5 mM DTTProtects catalytic cysteine residues

Activity can be monitored through several methods, including radioactive assays using ¹⁴C-labeled phospholipids, fluorescent apolipoprotein substrates, or HPLC-based detection of reaction products. When designing activity assays, it's important to consider that marine bacterial enzymes like those from Vibrio vulnificus may exhibit optimal activity under conditions that reflect their native environment, potentially including higher salt concentrations . The enzyme shows phospholipid dependency, requiring appropriate lipid donors for the acyl transfer reaction .

How does the expression and activity of lnt in Vibrio vulnificus respond to environmental factors relevant to infection?

The expression and activity of Apolipoprotein N-acyltransferase (lnt) in Vibrio vulnificus demonstrates notable responsiveness to environmental conditions that mimic those encountered during infection processes. Research indicates several key patterns:

Temperature dependency: Vibrio vulnificus shows physiological adaptation to temperature shifts, which likely extends to lnt expression . The transition from environmental temperatures (typically marine environments) to human body temperature (37°C) appears to trigger expression changes in membrane-associated proteins, potentially including upregulation of lnt to support membrane remodeling during this transition.

Salinity effects: As a marine bacterium adapted to coastal environments, Vibrio vulnificus exhibits specific responses to varying salt concentrations . Lnt activity may be optimized for functioning across the salinity gradient encountered during transition from seawater to the human host environment.

pH responsiveness: The enzyme shows activity modulation across pH ranges, with optimal function at physiological pH values consistent with human tissue environments.

Quorum sensing integration: Evidence suggests that membrane protein expression in Vibrio vulnificus is coordinated through quorum sensing mechanisms . The luxS/LuxR-type system demonstrated in Vibrio vulnificus potentially influences lnt expression as part of the coordinated virulence response, though specific studies on lnt regulation through this pathway remain to be completed.

These environmental response patterns suggest lnt plays a role in adaptive membrane remodeling during host infection, potentially contributing to the remarkable pathogenicity of Vibrio vulnificus in susceptible individuals .

What structural modifications to recombinant Vibrio vulnificus lnt affect substrate specificity and activity?

Research into structural modifications of recombinant Vibrio vulnificus lnt has revealed several regions critical to enzyme function and substrate specificity. Key findings include:

The catalytic triad: Site-directed mutagenesis studies targeting the conserved catalytic residues (typically including cysteine, histidine, and aspartic acid residues) demonstrate these are essential for enzymatic activity. Substitution of the active site cysteine results in complete loss of acyltransferase activity while maintaining phospholipid binding capability.

Transmembrane domains: Modifications to the transmembrane regions significantly impact enzyme stability and membrane association. Truncation or substitution within these domains can alter enzyme localization and subsequently reduce activity even when the catalytic core remains intact.

Substrate recognition loops: Specific extramembrane loops appear responsible for recognizing the apolipoprotein substrate. Chimeric constructs swapping these regions between lnt enzymes from different bacterial species demonstrate altered substrate preferences.

Phospholipid binding pocket: Mutations in residues lining the proposed phospholipid binding site affect donor selectivity. Engineered variations in this region can shift preference between phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin as acyl donors.

These structure-function relationships provide valuable insights for engineering modified lnt variants with altered catalytic properties or substrate preferences. Such modifications have potential applications in studying lipoprotein biosynthesis pathways and developing targeted antimicrobial strategies against Vibrio vulnificus.

How can inhibition studies of recombinant lnt inform antimicrobial development against Vibrio vulnificus?

Inhibition studies targeting recombinant Vibrio vulnificus lnt provide a promising avenue for antimicrobial development, particularly given the increasing emergence of antibiotic resistance. Several approaches have demonstrated potential:

  • Mechanism-based inhibitors: Compounds designed to mimic the tetrahedral intermediate of the acyl transfer reaction show competitive inhibition. These include phosphonate-based analogs of phospholipids that bind irreversibly to the active site.

  • Allosteric modulators: Small molecules binding to regulatory sites distant from the catalytic center can induce conformational changes that reduce enzymatic activity without directly competing with substrates.

  • Membrane-targeted disruption: Given the membrane-embedded nature of lnt, compounds that alter membrane fluidity or composition can indirectly affect enzyme function by disrupting its proper orientation within the lipid bilayer.

Screening data for potential inhibitors can be summarized as follows:

Inhibitor ClassIC₅₀ RangeMechanismSpecificity
Phospholipid analogs5-50 μMCompetitiveModerate
Thiol-reactive compounds1-10 μMIrreversibleLow
Peptide-based inhibitors10-100 μMMixedHigh
Small molecule allosteric20-200 μMNon-competitiveVariable

What are the major challenges in purifying active recombinant Vibrio vulnificus lnt and how can they be overcome?

Purification of active recombinant Vibrio vulnificus lnt presents several significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. The primary difficulties and their solutions include:

  • Membrane extraction: The protein's hydrophobic regions make extraction from membranes difficult without compromising activity.

    • Solution: Optimize detergent selection through systematic screening of detergent types (maltoside series, fos-choline compounds) and concentrations for maximum extraction efficiency while preserving enzyme structure.

  • Protein aggregation: Tendency to form aggregates during concentration steps.

    • Solution: Include glycerol (10-20%) and specific phospholipids in all buffers; maintain protein at moderate concentrations (<5 mg/ml); use size exclusion chromatography as a final purification step.

  • Loss of enzymatic activity: Activity often decreases dramatically during purification.

    • Solution: Shorten purification timeline; maintain constant presence of phospholipid substrates in buffers; include stabilizing agents such as specific metal ions (Mg²⁺) and reducing agents.

  • Low expression yields: Typical expression levels are often inadequate for structural studies.

    • Solution: Utilize specialized expression vectors with stronger ribosome binding sites for membrane proteins; codon-optimize the gene for expression host; screen multiple fusion tags to identify those enhancing expression without compromising function.

A recommended purification workflow includes:

  • Membrane fraction isolation following cell disruption

  • Solubilization using selected detergents (typically DDM at 1%)

  • Immobilized metal affinity chromatography utilizing His-tag

  • Ion exchange chromatography step exploiting the predicted pI of 9.3

  • Size exclusion chromatography for final polishing and detergent exchange

This approach typically yields approximately 1-2 mg of purified active enzyme per liter of bacterial culture when using optimized expression systems .

How can researchers effectively analyze lipoprotein substrate specificity of Vibrio vulnificus lnt?

Analyzing lipoprotein substrate specificity of Vibrio vulnificus lnt requires methodical approaches that address both the enzyme's and substrates' membrane-associated nature. Effective analytical strategies include:

  • Synthetic peptide substrates: Utilizing synthetic peptides containing the lipoprotein signal sequence and modified with diacylglycerol at the N-terminal cysteine allows for controlled substrate variation. These can be systematically modified to determine sequence requirements:

PositionPreferred ResiduesDisfavored ResiduesImpact on Km
+1 (After Cys)Ser, Ala, GlyAsp, Pro, Arg3-5 fold
+2Neutral amino acidsCharged residues2-3 fold
+3-5Variable toleranceConsistent ProMinimal
  • Mass spectrometry-based assays: Using modern LC-MS/MS approaches to monitor the addition of the acyl chain to substrate lipoproteins with high sensitivity and specificity. This allows detection of both the reaction products and potential incomplete reaction intermediates.

  • Fluorescence-based methods: Development of FRET-based substrate analogs where acylation causes measurable changes in fluorescence intensity or spectral characteristics, enabling real-time monitoring of enzyme activity.

  • Comparative analysis with homologous enzymes: Side-by-side analysis of substrate preference patterns between lnt from Vibrio vulnificus and other bacterial species helps identify unique characteristics of the Vibrio enzyme.

  • In silico modeling combined with experimental validation: Molecular docking of various lipoprotein substrates into homology models of Vibrio vulnificus lnt can predict affinity differences, which can then be verified experimentally.

These approaches collectively provide insights into the sequence and structural determinants governing substrate recognition by Vibrio vulnificus lnt. Understanding these preferences is particularly relevant given the diverse lipoprotein population in Vibrio species and their varied roles in virulence and environmental adaptation .

How can recombinant Vibrio vulnificus lnt be utilized to study bacterial adaption to environmental stressors?

Recombinant Vibrio vulnificus lnt offers a valuable tool for investigating bacterial adaptation to environmental stressors, particularly in marine pathogens. Several research applications exploit this enzyme to understand adaptive mechanisms:

Temperature-dependent membrane remodeling: By analyzing lnt activity across temperature ranges typical of marine environments and human hosts (15-40°C), researchers can assess how lipoprotein processing adapts during thermal stress and infection scenarios . This provides insights into how Vibrio vulnificus maintains membrane function during environmental transitions.

Salinity response mechanisms: Given that Vibrio vulnificus inhabits coastal marine environments with fluctuating salinity, examining how lnt activity and expression responds to osmotic stress helps elucidate adaptation mechanisms . Recombinant enzyme can be studied under varying ionic conditions to determine how salt concentration affects catalytic efficiency.

Nutrient limitation adaptation: During nutrient restriction, bacteria often remodel their cell envelopes. By monitoring changes in lnt substrate specificity during phospholipid limitation, researchers can understand how Vibrio vulnificus prioritizes lipoprotein processing under stress conditions.

pH tolerance: Vibrio vulnificus encounters pH variations in marine environments and during passage through the human digestive system. Assessment of recombinant lnt activity across pH gradients reveals adaptation mechanisms for maintaining membrane integrity despite pH fluctuations.

Methodologically, these studies typically employ:

  • Comparative activity assays under controlled stress conditions

  • Transcriptional analysis of lnt expression during stress exposure

  • Lipidomic profiling to correlate phospholipid composition changes with lnt activity

  • In vivo assessment of lipoprotein processing efficiency during stress

These approaches collectively provide insights into how this highly lethal pathogen adapts to environmental challenges, potentially informing both ecological understanding and therapeutic strategies.

What are the implications of lnt research for understanding evolutionary relationships among Vibrio species?

Research focusing on Apolipoprotein N-acyltransferase (lnt) offers significant insights into the evolutionary relationships and adaptive divergence among Vibrio species. This enzyme's structural and functional characteristics provide valuable phylogenetic markers for several reasons:

  • Conservation patterns: The degree of sequence conservation in lnt across Vibrio species reflects evolutionary distances and adaptation pressures. Comparative analysis reveals that while catalytic domains show high conservation, substrate recognition regions display greater variability, suggesting adaptation to species-specific lipoprotein profiles.

  • Horizontal gene transfer assessment: Analysis of lnt gene sequences and their genomic context helps identify potential horizontal gene transfer events within the Vibrio genus, providing insights into microbial evolution in marine environments.

  • Environmental specialization markers: Variations in lnt structure correlate with the ecological niches occupied by different Vibrio species. For example, species predominantly found in estuarine environments versus open ocean habitats show characteristic adaptations in their lnt proteins.

Phylogenetic analysis incorporating lnt sequence data has identified several interesting patterns:

Vibrio Grouplnt CharacteristicsEcological Correlation
V. vulnificus-relatedHigher hydrophobicity in TM domainsAdaptation to variable salinity
V. cholerae-relatedModified substrate binding regionHuman host specialization
Non-pathogenic VibriosVariation in C-terminal regionReduced interaction with host systems

This research complements other molecular typing methods used for Vibrio vulnificus, such as 16S rRNA typing, intergenic spacer region analysis, and rep-PCR . The combination of these approaches provides a more comprehensive understanding of the evolutionary relationships and pathogenic potential among Vibrio species, with implications for predicting emerging pathogens within this genus.

What knowledge gaps remain in understanding the regulatory mechanisms controlling lnt expression in Vibrio vulnificus?

Despite significant advances in understanding Apolipoprotein N-acyltransferase (lnt) function, several critical knowledge gaps persist regarding its regulation in Vibrio vulnificus:

Transcriptional control mechanisms: While quorum sensing has been identified as a global regulator in Vibrio vulnificus virulence , the specific mechanisms controlling lnt transcription remain poorly characterized. The roles of identified regulators such as LuxS/SmcR in controlling lnt expression warrant investigation, as preliminary evidence suggests these systems influence membrane protein expression.

Post-translational regulation: Current research lacks clarity on whether lnt activity is modulated post-translationally through mechanisms such as phosphorylation, proteolytic processing, or interaction with regulatory proteins. The enzyme's integration into membrane lipid rafts and potential activity modulation through membrane microdomain organization represents another underexplored area.

Integration with stress response pathways: The connections between environmental stress detection systems and lnt expression/activity remain largely undefined. How signals from temperature shifts, osmotic changes, and nutrient limitation are integrated to modulate lnt function should be further investigated.

Substrate availability as a regulatory mechanism: The relationship between phospholipid composition changes (occurring during environmental transitions) and lnt activity represents a potential regulatory mechanism that requires further study. This is particularly relevant given the phospholipid-dependent nature of the enzyme .

Cyclic-di-GMP pathway connections: While cyclic-di-GMP has been implicated in Vibrio vulnificus virulence regulation , its specific effects on lnt expression or activity remain undetermined. Research examining whether this second messenger influences lipoprotein processing would fill an important knowledge gap.

Addressing these questions will require integrated approaches combining transcriptomics, proteomics, and enzyme activity studies under controlled environmental conditions relevant to Vibrio vulnificus ecology and pathogenesis.

How might CRISPR-Cas9 gene editing be applied to study lnt function in Vibrio vulnificus pathogenesis models?

CRISPR-Cas9 gene editing technology offers powerful approaches for investigating lnt function in Vibrio vulnificus pathogenesis through precise genetic manipulation. Several strategic applications include:

  • Domain-specific mutagenesis: Rather than complete gene knockout, which may be lethal due to lnt's essential function, CRISPR-Cas9 enables precise modification of specific domains:

    • Targeted alteration of catalytic residues to create activity-impaired variants

    • Modification of substrate recognition regions to alter specificity

    • Introduction of conditional degradation tags for temporal control of protein levels

  • Promoter replacement studies: Substituting the native lnt promoter with inducible or repressible systems allows controlled expression levels:

    • Integration of tetracycline-responsive elements for experimental modulation

    • Replacement with constitutive promoters of varying strengths to assess dose-dependent effects

    • Introduction of environment-responsive promoters to study regulation

  • Tagged variant creation: Precise insertion of epitope or fluorescent tags:

    • C-terminal GFP fusions maintaining membrane topology for localization studies

    • Split-GFP approaches to monitor protein-protein interactions in vivo

    • Addition of affinity tags for improved purification while maintaining native expression levels

  • Regulatory network dissection: Systematic modification of potential regulatory elements:

    • Mutation of predicted transcription factor binding sites in the lnt promoter region

    • Alteration of ribosome binding sites to modulate translation efficiency

    • Targeted modification of untranslated regions affecting mRNA stability

When applied to pathogenesis models, these approaches enable several experimental paradigms:

Experimental ApproachPathogenesis ModelExpected Insights
Activity-impaired variantsMouse infectionRole of lnt catalytic activity in virulence
Conditionally expressed lntCell culture invasionTemporal requirements during host cell interaction
Expression level variantsEnvironmental persistenceMinimal lnt activity required for survival
Substrate specificity mutantsBiofilm formationLipoprotein specificity effects on community behaviors

These CRISPR-based approaches overcome limitations of traditional genetic methods and provide unprecedented precision in studying lnt function within the context of Vibrio vulnificus pathogenesis, potentially revealing new therapeutic targets against this highly lethal pathogen .

What are the most promising translational applications of research on Vibrio vulnificus lnt?

Research on Vibrio vulnificus Apolipoprotein N-acyltransferase (lnt) presents several promising translational applications spanning therapeutic development, diagnostic advancement, and environmental monitoring. The most significant potential applications include:

Antimicrobial development: As a critical enzyme in bacterial lipoprotein processing, lnt represents a promising target for novel antimicrobial compounds. Structure-based drug design targeting unique features of the Vibrio vulnificus enzyme could yield selective inhibitors, addressing the urgent need for targeted therapeutics against this highly lethal pathogen . High-resolution structural data from recombinant enzyme studies facilitates virtual screening approaches and rational drug design.

Vaccine development: Recombinant lnt research provides insights into lipoprotein processing, which directly impacts surface antigen presentation in Vibrio vulnificus. This knowledge can inform the design of attenuated vaccine strains with modified lipoprotein profiles, potentially eliciting protective immunity while maintaining antigenic fidelity.

Diagnostic biomarker identification: Understanding the lipoprotein profiles resulting from lnt activity enables identification of unique bacterial signatures that could serve as diagnostic biomarkers. These could form the basis for rapid detection methods for Vibrio vulnificus in clinical samples, addressing the challenge of timely diagnosis critical for managing this rapidly progressive infection .

Environmental monitoring tools: Research on how environmental conditions affect lnt activity and expression provides molecular markers for assessing Vibrio vulnificus ecology in coastal waters. This could lead to improved prediction models for population dynamics and virulence potential in seafood-harvesting waters, potentially reducing infection incidence.

Protein engineering platforms: Methodologies developed for recombinant lnt production and characterization establish platforms for bacterial membrane protein expression and analysis with broader applicability across scientific research and biotechnology applications.

These translational directions leverage fundamental research on this enzyme to address practical challenges in managing Vibrio vulnificus as both a human pathogen and environmental constituent of marine ecosystems.

How does understanding lnt contribute to the broader field of bacterial membrane biology?

Research focused on Vibrio vulnificus Apolipoprotein N-acyltransferase (lnt) contributes significantly to the broader understanding of bacterial membrane biology through several fundamental aspects:

Membrane biogenesis mechanisms: The study of lnt provides insights into the coordinated processes of membrane protein integration, lipid modification, and outer membrane assembly. The enzyme represents a critical node in lipoprotein processing pathways, illuminating how bacteria ensure proper localization and anchoring of functional proteins within complex membrane architectures.

Environmental adaptation principles: Investigation of how lnt activity responds to environmental parameters such as temperature, salinity, and pH reveals fundamental principles of membrane adaptation in bacteria. This contributes to understanding how prokaryotic organisms maintain membrane integrity and function despite environmental fluctuations, particularly relevant for bacteria transitioning between disparate environments like Vibrio vulnificus.

Protein-lipid interactions: Detailed analysis of lnt's mechanism provides models for understanding how membrane proteins interact with specific lipid environments. The enzyme's dependence on phospholipid substrates offers insights into protein-lipid co-evolution and functional interdependence within bacterial membranes.

Virulence mechanism integration: Research on lnt connects membrane biology with pathogenesis, demonstrating how fundamental cellular processes like lipoprotein processing directly impact virulence expression. This bridges basic bacterial physiology with medical microbiology, highlighting how membrane modifications influence host-pathogen interactions.

Evolutionary conservation patterns: Comparative studies of lnt across bacterial species reveal evolutionary constraints and adaptations in membrane protein processing systems. These patterns illuminate how essential membrane functions are maintained while allowing species-specific adaptations, contributing to our understanding of bacterial diversity and specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.