Recombinant Vibrio vulnificus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in V. vulnificus Pathogenesis

ATP synthase is essential for energy production in V. vulnificus, particularly during infection. Key insights include:

  • In Vivo Metabolic Reprogramming: Transcriptomic analyses reveal that ATP synthase genes (including atpB) are upregulated during infection, indicating their critical role in bacterial survival under host conditions .

  • Proton Motive Force (PMF) Generation: ATP synthase generates PMF, which energizes iron acquisition systems like TonB (critical for virulence) . Disruption of PMF-linked pathways impairs motility, adhesion, and toxin production .

  • Energy Dependency: V. vulnificus relies on ATP synthase for intracellular ATP production, especially in iron-limited host environments .

Key Studies

  • In Vivo ATP Synthesis:

    • A V. vulnificus mutant lacking NADH dehydrogenase (complex I) exhibited 22-fold reduced ATP levels in a rat peritoneal infection model, highlighting the interdependence of respiratory complexes and ATP synthase .

    • ATP synthase activity was indispensable for maintaining virulence, as mutants showed impaired growth in vivo and reduced lethality .

Experimental ModelFindingReference
Rat peritoneal infectionATP synthase I cluster (Vv1_1014–Vv1_1022) showed increased metabolic flux
In vitro vs. in vivo culturesatpB expression correlated with bacterial proliferation in host tissues

Applications and Implications

  • Antimicrobial Target: ATP synthase is a potential target for inhibitors disrupting bacterial energy metabolism .

  • Diagnostic Development: Recombinant atpB could serve as an antigen for detecting V. vulnificus infections .

  • Systems Biology: Used to model metabolic flux shifts during infection, aiding virulence mechanism studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize developing it for your order.
Synonyms
atpB; VV3257; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
atpB
Target Protein Sequence
MAAPGEALTPSGYITHHLTNLSTYKLGLVAEESSFWNVHIDSLFFSWFTGLIFLGIFYAV ARKTTAGVPGKLQCAVEMIVEFVATNVKDTFHGRNPLIAPLALTIFCWVFLMNLMDLVPI DFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFARELALHPF NHWTMIPFNLLIEVVSLLAKPLSLGMRLFGNMFAGEVVFILCAAMLPWYLQWMGSLPWAI FHILVILIQAFVFMMLTIVYMSMAHEDSDH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a crucial component of the proton channel. It directly participates in the translocation of protons across the membrane.
Database Links

KEGG: vvy:VV3257

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase system in Vibrio vulnificus?

ATP synthase in V. vulnificus serves as the primary enzyme complex responsible for ATP production through oxidative phosphorylation. Like in other bacteria, it utilizes the proton motive force (PMF) generated across the cell membrane to drive ATP synthesis. V. vulnificus exhibits significant metabolic reprogramming following infection, with the ATP synthase I cluster (Vv1_1014 to Vv1_1022) showing increased metabolic fluxes during in vivo analyses . This complex plays a crucial role in energy production, particularly during V. vulnificus infection within the host environment.

How does ATP synthase function change during V. vulnificus infection?

During infection, V. vulnificus undergoes profound environmental shifts from its natural estuarine habitat to the human host environment. Research has revealed extensive metabolic reprogramming post-infection, with over 150 genes identified as up-regulated in vivo . The ATP synthase I gene cluster becomes especially important in energy production during infection, as evidenced by in vivo growth retardation and reduced intracellular ATP levels in insertion mutants under oxygen-limited conditions .

What is the role of subunit a (atpB) in the ATP synthase complex?

The subunit a (atpB) forms a critical component of the membrane-embedded Fo portion of ATP synthase. This subunit contains the proton channel that allows H+ ions to flow through the membrane, driving the rotary mechanism of ATP synthesis. While specific structural information about V. vulnificus atpB is limited in the available research, the subunit likely functions similarly to those in other bacterial species, playing an essential role in coupling proton translocation to ATP generation.

How does V. vulnificus adapt its energy metabolism during infection?

V. vulnificus demonstrates significant metabolic reprogramming upon infection. Computational simulations using the genome-scale metabolic network model VvuMBEL943 have revealed discrepancies in metabolic pathways, with specific gene clusters showing heightened metabolic fluxes despite lacking in vivo up-regulation . Notably, the ATP synthase I cluster exhibits significant increases in metabolic fluxes during in vivo analyses, suggesting a critical adaptation for energy production in the host environment.

What is the relationship between NADH dehydrogenase and ATP synthesis?

Research has identified NADH dehydrogenase (complex I) as significantly up-regulated in vivo, while complexes II, III, and IV are down-regulated . This suggests a distinctive mechanism for ATP generation during infection. NADH dehydrogenase (Vv1_2074) appears to play a crucial role in generating the proton motive force necessary for ATP synthase I function specifically during established V. vulnificus infections . Deletion mutants of complex I showed no significant differences in growth or intracellular ATP levels under in vitro conditions but exhibited pronounced in vivo growth retardation and reduced intracellular ATP levels, which were reversible upon gene reversion .

How does oxygen availability affect ATP production strategies?

V. vulnificus must adapt to varying oxygen conditions during infection. Studies indicate that ATP synthase I is particularly important under oxygen-limited conditions, as evidenced by reduced growth and ATP levels in insertion mutants under these conditions . This suggests the bacterium employs different ATP production strategies depending on oxygen availability, with ATP synthase I playing a critical role in low-oxygen environments typically encountered during infection.

What methods are used to study ATP synthase function in V. vulnificus?

Researchers employ various techniques to investigate ATP synthase function in V. vulnificus:

  • Transcriptomic analyses to assess gene expression levels of ATP synthase components and related systems

  • Quantitative real-time PCR (qRT-PCR) to measure transcriptional expression of specific genes

  • Creation of deletion mutants through allelic exchange methods

  • In vivo infection models, such as rat peritoneal infection models, to study pathogen behavior in host environments

  • Measurement of intracellular ATP levels under various conditions

  • Systems biology approaches using genome-scale metabolic network models

What challenges exist in expressing recombinant V. vulnificus ATP synthase subunits?

Expression of recombinant ATP synthase subunits presents several challenges. The membrane-embedded nature of many ATP synthase components, including subunit a (atpB), makes them difficult to express in soluble, correctly folded forms. Additionally, the complex assembly of the ATP synthase requires appropriate chaperones and assembly factors that may be species-specific. Researchers must carefully select expression systems and conditions to maintain the structural integrity and functionality of these proteins.

How do environmental signals regulate ATP synthase expression?

Environmental signals play critical roles in regulating ATP synthase expression in V. vulnificus. The bacterium experiences dramatic environmental changes when transitioning from estuarine habitats to human hosts. Research shows that V. vulnificus undergoes significant metabolic reprogramming following infection, with differential expression of genes involved in energy production . While specific regulatory mechanisms for ATP synthase genes are not fully elucidated, the observed metabolic shifts suggest sophisticated regulatory networks responsive to environmental cues like oxygen availability, nutrient conditions, and host factors.

What is the relationship between iron acquisition and ATP synthesis in V. vulnificus?

Iron acquisition and ATP synthesis appear interconnected in V. vulnificus pathogenesis. The bacterium possesses three TonB systems essential for iron transport across the outer membrane . Interestingly, these TonB systems contribute to flagellar biogenesis, which affects motility, adhesion, and ultimately virulence . The connection between iron acquisition and energy metabolism is further supported by the observation that flagellar motility genes are induced under conditions of sufficient iron . This suggests that adequate iron acquisition may indirectly support ATP production by enabling proper expression of motility genes and other virulence factors.

How does ATP synthase contribute to V. vulnificus pathogenesis?

ATP synthase contributes significantly to V. vulnificus pathogenesis by ensuring adequate energy production during infection. The ATP synthase I cluster shows increased metabolic fluxes during in vivo analyses, indicating its importance in the host environment . Energy production is fundamental to various virulence mechanisms, including motility, toxin production, and resistance to host defenses. Disruption of ATP production pathways, as demonstrated in deletion mutants, leads to attenuated virulence, highlighting the central role of energy metabolism in pathogenesis.

What expression systems are most effective for recombinant V. vulnificus ATP synthase subunits?

For membrane proteins like ATP synthase subunit a (atpB), specialized expression systems are typically required. E. coli-based systems with tightly controlled induction mechanisms (like pET series vectors) often serve as initial platforms. For challenging membrane proteins, alternative hosts like C41(DE3) or C43(DE3) E. coli strains (specifically designed for membrane protein expression) may yield better results. Cell-free expression systems represent another option, potentially allowing direct incorporation into nanodiscs or liposomes to maintain native conformation.

What purification challenges are specific to ATP synthase subunit a?

Purification of ATP synthase subunit a presents several challenges due to its highly hydrophobic nature and membrane integration. Multiple transmembrane domains make it prone to aggregation when removed from the membrane environment. Effective purification typically requires careful selection of detergents to solubilize the protein while maintaining its structure. Additionally, the subunit often requires association with other ATP synthase components for stability, making isolation of the individual subunit particularly challenging.

How can researchers verify the functionality of recombinantly expressed atpB?

Verification of recombinant atpB functionality requires specialized assays. Researchers might reconstitute the purified protein into liposomes and measure proton translocation activities. Alternatively, complementation studies using atpB-deficient strains can demonstrate functional rescue. Structural integrity can be assessed through circular dichroism to evaluate secondary structure, while proper membrane insertion might be verified using protease accessibility assays. These approaches collectively help ensure that recombinantly expressed atpB maintains its native function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.