Recombinant Vibrio vulnificus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Heterologous Expression in E. coli

  • Expression Systems: Vibrio cobS genes (e.g., V. cholerae cobS) are cloned into plasmids (e.g., pET28a) and expressed in E. coli ΔcobS strains to study activity .

  • Functional Validation:

    • Cobalamin Salvaging: Recombinant CobS enables E. coli to convert cobinamide (incomplete B₁₂ precursor) into adenosylcobalamin .

    • Pseudocobalamin Remodeling: V. cholerae CobS directly remodels pseudocobalamin (microbial cobamide) into cobalamin, a unique mechanism absent in non-Vibrio homologs .

Comparative Activity Across Vibrio Species

SpeciesCobinamide Salvaging EfficiencyPseudocobalamin Remodeling EfficiencyReference
V. cholerae85%92%
V. fluvialis78%88%
V. splendidus70%82%

Key Observations:

  • Vibrio CobS enzymes share ~55–66% amino acid similarity, with conserved active-site residues .

  • Remodeling activity requires adenosylated pseudocobalamin (Ado-psCbl) as an intermediate .

Role in Pathogenesis and Environmental Adaptation

While V. vulnificus CobS has not been directly linked to virulence, cobalamin is critical for:

  • Iron Metabolism: Cobalamin-dependent pathways facilitate iron acquisition, a key virulence factor in V. vulnificus .

  • Antibiotic Resistance: CobS-associated pathways may indirectly enhance survival under stress (e.g., via CRP-regulated systems) .

Research Gaps and Future Directions

  • Structural Studies: No crystal structures of V. vulnificus CobS are available; homology modeling based on V. cholerae is needed.

  • Pathogenic Role: Direct investigation into CobS’s contribution to V. vulnificus infection dynamics (e.g., serum survival, host iron utilization).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; VV1475; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
cobS
Target Protein Sequence
MKTWQYQYQLFCLAVSFFSRLPVPKSTPYSDERMNQAGRYFALVGTLLGLLCVLVYAFAS LFFPYQVAIVLMMAFSLLLTGAFHEDGLTDMADGIGGGMTLDKRLTIMKDSRIGTYGSAT LTMALIGKFVFLTTLARQPDFGLMIVVAYTLSRAVAATLIYDMPYVSDSDTSKSKPLANA QSSTELAILILTGVLAAISLGLGVGLLLILFAILFRWAFKRWLLARLGGFTGDCLGGAQQ LMELGIYLVLIAVVQ
Uniprot No.

Target Background

Function
Catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: vvy:VV1475

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What PCR-based techniques are most effective for amplifying the cobS gene from different Vibrio vulnificus strains?

    Optimal amplification of the cobS gene from Vibrio vulnificus requires careful consideration of strain variability. Based on research methodologies applied to other V. vulnificus genes, researchers should first extract genomic DNA using standard bacterial lysis methods followed by phenol-chloroform extraction. For PCR amplification, design primers targeting conserved regions flanking the cobS gene based on available genome sequences. The high success rate of amplifying rtxA1 gene regions in diverse V. vulnificus strains (40 Biotype 1 strains) suggests similar approaches would be effective for cobS . Use gradient PCR to optimize annealing temperatures, particularly important given V. vulnificus' GC content of approximately 46.75% . When capturing the amplified product, consider using plasmid vectors with compatible restriction sites for directional cloning, similar to the approach used in studying rtxA1 gene variants . For strains showing amplification difficulties, touchdown PCR or the addition of PCR enhancers like DMSO (5-10%) may overcome problems associated with secondary structure formation.

  • How do genome variations between clinical and environmental Vibrio vulnificus isolates potentially affect cobS expression and function?

    Genome variations between clinical and environmental V. vulnificus isolates likely impact cobS expression and function in several key ways. Research has demonstrated that V. vulnificus isolates typically comprise two main genomes with sizes ranging from 4,900,883 bp to 5,296,751 bp and an average GC content of 46.75% . Clinical isolates often exhibit distinct genetic profiles from environmental strains, including differences in 16S rRNA types and vcg types, with most clinical isolates being classified as vcg C type . Similar to the genetic variation observed in the rtxA1 gene, which shows four distinct variants with different arrangements of effector domains, the cobS gene may display polymorphisms that affect protein structure and function . To investigate these variations, researchers should sequence cobS from multiple isolates representing both clinical and environmental sources, then perform comparative genomic analysis to identify conserved and variable regions. Expression studies under various growth conditions would help determine if clinical isolates exhibit different cobS expression patterns compared to environmental isolates, potentially correlating with metabolic differences that contribute to virulence.

  • What expression systems provide optimal yield and activity for recombinant Vibrio vulnificus cobS protein?

    Selection of an optimal expression system for recombinant V. vulnificus cobS requires balancing protein yield with enzyme activity. Based on research with other bacterial proteins, E. coli BL21(DE3) remains the first-choice expression host due to its reduced protease activity and high expression efficiency. For cobS specifically, consider these methodological approaches: (1) Utilize vectors with inducible promoters like pET or pBAD systems to control expression levels, as overexpression could lead to inclusion body formation; (2) Express with an N-terminal His-tag for purification while ensuring the tag doesn't interfere with the enzyme's active site; (3) Optimize expression temperature, typically lowering to 16-25°C after induction to enhance proper folding of the cobS protein; (4) Supplement growth media with relevant cofactors that might enhance cobS folding and activity, particularly considering that cobS is involved in cobalamin biosynthesis; (5) Consider cell-free expression systems for enzymes that prove difficult to express in vivo. After expression, verify enzyme activity through functional assays measuring cobalamin production. If E. coli expression yields poor results, alternative hosts like Vibrio species expression systems might preserve native folding patterns, particularly important for enzymes involved in complex metabolic pathways.

  • What structural and functional variations might exist in cobS across different Vibrio vulnificus lineages?

    Research on V. vulnificus has identified significant genetic diversity across strains, suggesting potential structural and functional variations in cobS. Studies of the rtxA1 gene revealed four distinct toxin variants resulting from recombination events, with different arrangements of effector domains . Similarly, cobS may exhibit lineage-specific variations that affect enzyme function. Genome analysis of V. vulnificus isolates shows they fall into distinct lineages, with lineage I strongly correlated with human clinical strains . To characterize cobS variations across these lineages, researchers should: (1) Sequence the cobS gene from representative strains of different lineages; (2) Perform phylogenetic analysis to identify evolutionary relationships and potential recombination events; (3) Use protein modeling to predict structural differences in the cobS enzyme across lineages; (4) Express recombinant cobS variants and compare their enzymatic activities in standardized assays; (5) Correlate any observed functional differences with specific amino acid substitutions. This approach would reveal whether cobS, like other genes in V. vulnificus, undergoes lineage-specific adaptation that might influence bacterial metabolism and potentially virulence.

  • What purification strategies maintain optimal stability and activity of recombinant cobS enzyme?

    Purification of recombinant cobS requires strategies that preserve the enzyme's native conformation and catalytic activity. A methodological approach should include: (1) Cell lysis under mild conditions using techniques like sonication with short pulses or enzymatic lysis with lysozyme to minimize protein denaturation; (2) Buffer optimization—maintain pH between 7.0-8.0 with appropriate ionic strength, and include stabilizing agents such as glycerol (10-20%) to prevent aggregation; (3) Affinity chromatography using immobilized metal affinity chromatography (IMAC) if the recombinant cobS contains a His-tag; (4) Size exclusion chromatography as a polishing step to separate active oligomeric forms from aggregates; (5) Activity assays at each purification step to track enzyme activity and identify conditions that preserve function. Consider including reducing agents like DTT or β-mercaptoethanol to maintain any critical thiol groups in their reduced state. For long-term storage, flash-freeze aliquots in liquid nitrogen with cryoprotectants like glycerol or sucrose and store at -80°C to maintain enzyme activity. During functional characterization, assess enzyme stability under various buffer conditions to identify optimal formulations for maximum activity retention.

Advanced Research Questions

  • How might genetic recombination events observed in Vibrio vulnificus potentially affect cobS gene evolution?

    Genetic recombination appears to be a significant driver of genetic diversity in V. vulnificus, with important implications for cobS evolution. Research demonstrates that the rtxA1 gene has undergone multiple recombination events, resulting in four distinct toxin variants with different arrangements of effector domains . These recombination events occurred either with rtxA genes carried on plasmids or with rtxA genes from other marine pathogens like Vibrio anguillarum . Similar recombination mechanisms could affect the cobS gene, potentially leading to functional variations in cobalamin synthesis. To investigate this possibility, researchers should: (1) Sequence cobS genes from diverse V. vulnificus isolates; (2) Apply bioinformatic tools specifically designed to detect recombination events, such as RDP4 or GARD; (3) Identify potential donor sequences from related Vibrio species or plasmids; (4) Express and characterize recombinant proteins from different cobS variants to assess functional consequences of recombination; (5) Map recombination breakpoints to understand how they relate to protein domains. The evidence of ongoing recombination in V. vulnificus suggests that cobS, like other genes, may continue to evolve through horizontal gene transfer, potentially acquiring new functions or regulatory mechanisms that could affect bacterial metabolism and adaptation.

  • What methodological approaches can determine the relationship between cobalamin synthesis and virulence in Vibrio vulnificus?

    Investigating the relationship between cobalamin synthesis and virulence in V. vulnificus requires a multifaceted experimental approach. Research has established that V. vulnificus possesses numerous virulence factors, including capsule (CPS), lipopolysaccharide (LPS), and multifunctional autoprocessing repeats-in-toxin (MARTX) . To explore potential connections between cobalamin synthesis and virulence, researchers should: (1) Create cobS gene knockout mutants using CRISPR-Cas9 or allelic exchange methods, then assess changes in virulence using both in vitro and in vivo models; (2) Perform transcriptomic analysis comparing wild-type and cobS-deficient strains to identify virulence genes whose expression depends on functional cobalamin synthesis; (3) Conduct metabolomic profiling to understand how cobalamin deficiency affects other metabolic pathways that might influence virulence; (4) Assess the impact of cobS mutation on known virulence phenotypes such as serum resistance, which has been shown to vary among V. vulnificus isolates (from grade 1 to grade 3) ; (5) Evaluate whether cobS expression correlates with clinical versus environmental isolates, similar to observations with other virulence-associated genes. This methodological approach would determine whether cobalamin synthesis plays a direct or indirect role in V. vulnificus pathogenesis, potentially identifying new therapeutic targets.

  • How can whole genome sequencing and comparative genomics inform cobS function in different Vibrio vulnificus strains?

    Whole genome sequencing provides powerful insights into cobS function across different V. vulnificus strains. Research shows that V. vulnificus isolates possess genome sizes ranging from 4,900,883 bp to 5,296,751 bp with variation in gene content . To leverage genomic data for understanding cobS function, researchers should: (1) Perform whole genome sequencing of multiple V. vulnificus strains representing clinical and environmental isolates; (2) Identify cobS and other cobalamin synthesis genes through sequence homology and functional annotation; (3) Analyze the genomic context of cobS to identify potential operonic structures and regulatory elements; (4) Compare cobS sequences across strains to identify conserved catalytic residues versus variable regions; (5) Use synteny analysis to determine if genome rearrangements have affected cobS location and potentially its regulation. Functional annotation through KEGG pathway analysis, as performed for strain S12 which revealed genes involved in metabolism (1534), environmental information processing (367), and genetic information processing (233) , can provide context for cobS function within metabolic networks. By integrating these genomic approaches, researchers can develop hypotheses about cobS evolution, regulation, and functional importance in different ecological niches.

  • What protein-protein interaction studies would elucidate cobS's role in the cobalamin synthesis pathway of Vibrio vulnificus?

    Understanding cobS's interactions with other proteins in the cobalamin synthesis pathway requires multiple complementary approaches. Researchers should implement the following methodological strategy: (1) Perform co-immunoprecipitation (Co-IP) experiments using antibodies against tagged recombinant cobS to identify interacting proteins in V. vulnificus lysates; (2) Apply bacterial two-hybrid screening to systematically identify binary protein interactions; (3) Utilize cross-linking mass spectrometry (XL-MS) to capture transient interactions and determine proximity relationships between cobS and other proteins; (4) Employ surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding affinities between purified cobS and candidate interacting proteins; (5) Construct protein-protein interaction networks by integrating experimental data with bioinformatic predictions. Additionally, researchers should investigate whether cobS interacts with virulence-associated proteins, given that V. vulnificus possesses numerous virulence factors including MARTX toxins, CPS, and LPS . By mapping cobS's interaction network, researchers can determine its integration within broader metabolic and virulence-related processes, potentially identifying novel regulatory mechanisms or auxiliary functions beyond its catalytic role in cobalamin synthesis.

  • How do environmental factors affect cobS expression and function in different Vibrio vulnificus lineages?

    Environmental adaptation appears to influence V. vulnificus gene expression and could significantly impact cobS regulation. Research indicates that V. vulnificus strains from different sources exhibit varied characteristics, with lineage I strains being more commonly associated with human infection despite being less prevalent in oysters . To investigate environmental influences on cobS, researchers should: (1) Culture V. vulnificus isolates from different lineages under varying conditions that mimic different environments (temperature, salinity, pH, nutrient availability); (2) Use quantitative PCR (qPCR) to measure cobS transcript levels under these different conditions; (3) Implement RNA-Seq for global transcriptomic profiling to understand how cobS regulation fits within broader adaptive responses; (4) Assess cobS enzyme activity in cell extracts to correlate transcriptional changes with functional outcomes; (5) Compare environmental responses between clinical isolates (predominantly lineage I) and environmental isolates (predominantly lineage II) to identify lineage-specific regulatory patterns. This approach is particularly important given evidence that V. vulnificus undergoes genetic rearrangements that may be subject to environmental selection, as observed with the MARTX toxin variants . Understanding how environmental factors influence cobS expression and function could provide insights into V. vulnificus metabolic adaptation across different ecological niches and during host infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.