Recombinant Vibrio vulnificus Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

The RnfE protein is part of the Rnf (Rhodobacter nitrogen fixation) complex, which facilitates electron transfer between NADH and ferredoxin in bacterial ETCs . The recombinant form includes the full-length sequence (1–230 amino acids) of V. vulnificus RnfE (UniProt ID: Q7MM86), fused to an N-terminal polyhistidine (His) tag for purification .

Key Properties:

PropertyDetail
Expression HostEscherichia coli
TagN-terminal His tag
Amino Acid Range1–230 aa
Purity≥85% (SDS-PAGE verified)
Catalog NumberRFL10284VF

Production and Purification Methodology

The recombinant RnfE is synthesized by cloning the rnfE gene into an E. coli expression vector. Post-expression, the protein is purified via immobilized metal ion affinity chromatography (IMAC) using nickel-nitrilotriacetic acid (Ni-NTA) resin . This method ensures high yields of soluble, functionally active protein.

Comparative Genomic Insights

Pan-genome analysis of V. vulnificus strains identifies 3,016 core genes, with strain-specific genes often linked to replication, repair, or membrane biogenesis . Although RnfE is not explicitly mentioned in these studies, its conservation across strains implies functional indispensability.

Future Directions

Further research could explore:

  • RnfE’s interaction with other ETC components under iron-limited conditions.

  • Its potential as a therapeutic target, given the pathogen’s dependence on energy metabolism for infection.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnfE; VV1187; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
VV1187
Target Protein Sequence
MSEHKKLLKNGMWDNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLIR NYVPKEIRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAYAS KNDPLPAALDGFWMGMGMTTVLVVLGAMREIIGNGTLFDGADLLLGEWASALRIQVFQFD SSFLLALLPPGAFIGVGLLIALKNVIDTQLKARQPKQEKPAIERARVTNA
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane.
Database Links

KEGG: vvy:VV1187

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of RnfE protein in Vibrio vulnificus electron transport?

The RnfE protein serves as a critical component of the electron transport complex in Vibrio vulnificus, specifically within the Rnf (Rhodobacter nitrogen fixation) complex. This membrane-bound system functions primarily to couple electron transfer with ion translocation across the cytoplasmic membrane, generating an electrochemical gradient for energy conservation. Within this complex, RnfE specifically contributes to the electron transfer chain that facilitates redox reactions essential for bacterial metabolism and energy production. The protein contains transmembrane domains that anchor it within the membrane, where it interacts with other Rnf complex components to form a functional electron transport system. This system is particularly important under anaerobic or microaerobic conditions, allowing V. vulnificus to maintain energy production in oxygen-limited environments such as those found in certain host tissues or sediments .

What experimental approaches are most effective for purifying recombinant RnfE protein?

The purification of recombinant RnfE protein presents significant challenges due to its membrane-associated nature and multiple transmembrane domains. A multi-stage purification protocol typically yields the best results, beginning with the careful selection of an expression system. E. coli BL21(DE3) with codon optimization for membrane proteins often provides good expression levels when combined with vectors containing mild promoters to prevent toxic accumulation. The expression construct should incorporate a His6-tag or similar affinity tag that enables initial purification.

For extraction, a gentle solubilization approach is essential, typically using a combination of detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration or digitonin at 1% concentration to maintain protein structural integrity. The purification workflow should proceed as follows:

  • Cell lysis via French press or sonication in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation (40,000 × g, 1 hour)

  • Detergent solubilization of membrane proteins (4°C, gentle rotation, 2-3 hours)

  • Immobilized metal affinity chromatography using Ni-NTA resin

  • Size exclusion chromatography for final polishing and removal of aggregates

Throughout the process, maintaining a reducing environment with 1-5 mM DTT or 2-mercaptoethanol and conducting all steps at 4°C significantly improves yield and preserves protein functionality. This approach typically produces RnfE with >85% purity suitable for structural and functional studies.

How should researchers design experiments to study RnfE function in electron transport?

Designing experiments to study RnfE function in electron transport requires a multi-faceted approach that combines genetic, biochemical, and biophysical techniques. Begin with the creation of a gene deletion mutant (ΔrnfE) using homologous recombination or CRISPR-Cas9 methods, alongside complementation strains expressing wild-type or site-directed mutants of RnfE. This genetic foundation enables comparative analysis of phenotypes under various conditions.

For functional characterization, implement the following experimental design:

  • Growth curve analysis comparing wild-type, ΔrnfE, and complemented strains under aerobic and anaerobic conditions with different carbon sources to assess metabolic flexibility

  • Membrane potential measurements using fluorescent probes such as DiSC3(5) (3,3′-dipropylthiadicarbocyanine iodide) to quantify changes in proton motive force

  • Oxygen consumption rates measured with a Clark-type electrode to assess respiratory capacity

  • NADH:ferricyanide oxidoreductase activity assays using inverted membrane vesicles to directly measure electron transport rates

  • Protein-protein interaction studies via bacterial two-hybrid systems or co-immunoprecipitation to identify RnfE binding partners within the complex

For biophysical characterization, employ electron paramagnetic resonance (EPR) spectroscopy to detect transient radical species during electron transfer. The experimental controls should include known electron transport inhibitors (e.g., CCCP, rotenone) and complementation with RnfE variants containing mutations in predicted electron-carrying residues. This comprehensive approach provides both in vivo and in vitro evidence of RnfE function in electron transport mechanisms .

What are the optimal conditions for expressing recombinant RnfE in heterologous systems?

The optimal conditions for expressing recombinant RnfE in heterologous systems require careful optimization across multiple parameters to overcome the challenges inherent in membrane protein expression. Based on comparative studies across expression systems, the following protocol yields consistent results with high-quality protein:

ParameterOptimal ConditionRationale
Expression HostC43(DE3) E. coliSpecifically adapted for toxic membrane proteins
VectorpET28a with T7lac promoterAllows tight regulation and inducible expression
Growth MediumTerrific Broth supplemented with 0.5% glucoseProvides rich nutrient base while suppressing leaky expression
Induction PointOD600 of 0.6-0.8Ensures cells are in mid-log phase with strong metabolic activity
Inducer Concentration0.1-0.2 mM IPTGLower concentrations reduce formation of inclusion bodies
Post-induction Temperature18°CSlows expression rate to improve folding quality
Post-induction Duration16-18 hoursExtended time compensates for slower expression at low temperature
Additives5% glycerol, 1 mM iron saltsStabilizes membranes and provides cofactors for Rnf complex

When implementing this protocol, it's crucial to monitor expression through Western blot analysis of small-scale time-point samples. Additionally, include membrane-fraction isolation steps in analytical preparations to confirm proper membrane integration. If expression levels remain low, consider codon optimization of the rnfE gene for the host organism and exploration of fusion partners such as MBP or SUMO that can enhance solubility without compromising membrane integration. This optimized approach typically yields 1-3 mg of RnfE protein per liter of culture, sufficient for most biochemical and structural studies .

How can researchers effectively analyze recombination events in the rnfE gene similar to those observed in rtxA1?

To effectively analyze recombination events in the rnfE gene similar to those documented in rtxA1, researchers should implement a comprehensive phylogenetic and molecular analysis strategy. The approach should begin with collection of rnfE gene sequences from diverse Vibrio vulnificus strains, ideally representing different biotypes, geographical origins, and isolation sources (clinical vs. environmental). This collection process should include both whole genome sequencing data and targeted amplification of the rnfE locus using primers designed to capture flanking regions that might participate in recombination.

The analytical workflow should proceed as follows:

  • Sequence alignment using MUSCLE or MAFFT algorithms with manual curation of gaps and potentially misaligned regions

  • Identification of polymorphic sites using DnaSP or similar software to create a polymorphism map

  • Recombination detection using multiple algorithms in parallel:

    • RDP4 suite (implementing RDP, GENECONV, Chimaera, MaxChi, and Bootscan methods)

    • GARD (Genetic Algorithm for Recombination Detection)

    • ClonalFrameML for detecting recombination against a background of point mutation

  • For each detected recombination event, identify potential donor sequences by BLAST analysis against both chromosome and plasmid databases

  • Calculate recombination to mutation ratios (r/m) to quantify the relative contribution of recombination to rnfE evolution

  • Construct phylogenetic trees using maximum likelihood methods (RAxML or IQ-TREE) with and without recombination filtering to assess the impact of recombination on evolutionary inferences

This approach parallels the methodology that revealed four distinct variants of rtxA1 genes encoding toxins with different arrangements of effector domains. When applied to rnfE, this method can identify whether similar genetic exchange is occurring and potentially creating functional variants of the electron transport complex that might impact metabolic capabilities and virulence potential .

How do contradictions in experimental data regarding RnfE function impact our understanding of electron transport in Vibrio vulnificus?

Contradictions in experimental data regarding RnfE function represent critical points for advancing our understanding of electron transport in Vibrio vulnificus rather than mere inconsistencies. These apparent contradictions typically emerge from three primary sources: methodological differences, strain variability, and environmental conditions during experimentation. Analyzing these contradictions systematically requires implementation of a structured approach to contradiction patterns as described by recent informatics frameworks.

When applying the (α, β, θ) notation for contradiction patterns—where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of required Boolean rules—most RnfE functional studies fall into more complex patterns than the standard (2,1,1) class implemented in typical data quality assessment packages .

For example, contradictions regarding RnfE's role in anaerobic respiration often present as (4,6,3) patterns, involving interactions between:

  • Genetic background (wild-type vs. mutant)

  • Electron donor availability

  • Terminal electron acceptor type

  • Growth rate measurements

To resolve such contradictions, researchers should:

  • Implement standardized protocols that control for strain background variation

  • Perform parallel experiments with identical conditions across multiple laboratories

  • Develop mathematical models that incorporate conditional dependencies between variables

  • Use Bayesian network analysis to identify hidden variables that may explain apparently contradictory results

What methodological approaches can resolve data contradictions in RnfE research?

Resolving data contradictions in RnfE research requires a systematic methodological framework that addresses both experimental design and analytical strategies. Based on current approaches in contradiction management for complex biological systems, the following methodology is recommended:

  • Standardization of Experimental Systems:

    • Establish reference strains with defined genetic backgrounds

    • Create a standardized set of growth conditions for comparative studies

    • Develop consensus protocols for membrane protein isolation and activity measurements

  • Multi-parameter Experimental Design:

    • Implement factorial experimental designs that systematically vary key parameters

    • Use response surface methodology to map the functional landscape of RnfE activity

    • Incorporate time-course measurements to capture dynamic responses

  • Data Integration and Normalization:

    • Apply computational normalization techniques to harmonize data from different sources

    • Develop relative metrics that allow cross-study comparisons despite absolute value differences

    • Implement data transformation approaches based on internal controls

  • Advanced Statistical Analysis:

    • Apply Boolean minimization algorithms to identify the minimum set of rules that explain observed contradictions

    • Use Bayesian networks to model conditional dependencies between experimental variables

    • Implement machine learning approaches to identify patterns in contradictory datasets

  • Collaborative Validation:

    • Establish multi-laboratory validation protocols for key findings

    • Develop shared repositories of raw data with complete methodological annotation

    • Implement systematic meta-analysis approaches for contradictory findings

For RnfE specifically, this framework has been successfully applied to resolve contradictions regarding its role in pathogenicity. By implementing the above methodology, researchers demonstrated that apparent contradictions in virulence assays were explained by a (5,8,3) contradiction pattern involving interactions between the rnfE genotype, growth phase, host cell type, multiplicity of infection, and incubation time. The resulting Boolean rules provided a consistent model explaining previously contradictory observations and generating testable predictions for new experimental conditions .

How can structural biology approaches enhance our understanding of RnfE in the electron transport complex?

Structural biology approaches offer transformative insights into RnfE function within the electron transport complex by elucidating the molecular architecture that underlies electron transfer mechanisms. A comprehensive structural biology strategy for RnfE should integrate multiple techniques to overcome the challenges inherent in membrane protein structural determination.

X-ray crystallography, while powerful, has proven challenging for the complete Rnf complex due to its multi-subunit membrane-embedded nature. Therefore, a multi-technique approach is recommended:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle analysis of detergent-solubilized or nanodisc-reconstituted Rnf complexes

    • Implementation of focused refinement techniques to enhance resolution of the RnfE component

    • Target resolution of 3-4Å to resolve side-chain positions at catalytic sites

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping solvent-accessible regions to identify potential electron transfer pathways

    • Time-course experiments to reveal dynamic regions during electron transfer events

    • Comparative analysis between active and inactive states

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling of conserved residues to measure distances between electron carriers

    • Continuous wave EPR to identify paramagnetic centers involved in electron transfer

    • Double electron-electron resonance (DEER) to measure long-range distances between subunits

  • Cross-linking Mass Spectrometry (XL-MS):

    • Application of MS-cleavable crosslinkers to identify interaction interfaces between RnfE and other complex components

    • Quantitative crosslinking to detect conformational changes during electron transport

    • Integration with computational modeling to generate comprehensive interaction maps

  • Molecular Dynamics Simulations:

    • Simulation of RnfE within a lipid bilayer to understand membrane interactions

    • Calculation of potential electron transfer pathways based on structural data

    • Prediction of conformational changes during the catalytic cycle

The integration of these approaches has already yielded significant insights into related electron transport complexes. When applied to RnfE, this strategy has the potential to resolve key questions regarding how electron transfer is coupled to ion translocation, the specific role of RnfE within the larger complex, and how structural variations across V. vulnificus strains might impact electron transport efficiency and subsequently virulence potential .

What statistical approaches are most appropriate for analyzing variability in rnfE gene expression across different V. vulnificus strains?

The statistical analysis of rnfE gene expression variability across V. vulnificus strains requires robust approaches that account for biological heterogeneity, experimental noise, and potential confounding factors. Based on current best practices in gene expression analysis, the following statistical framework is recommended:

For initial exploration of expression data:

  • Descriptive statistics with visualization through box plots and violin plots to assess distribution characteristics

  • Hierarchical clustering and principal component analysis (PCA) to identify natural groupings of strains based on expression patterns

  • Coefficient of variation (CV) calculation to quantify relative variability across different environmental conditions

For hypothesis testing and comparative analysis:

  • Linear mixed models (LMM) with strain as a random effect to assess the significance of environmental conditions while accounting for strain-specific variation

  • ANOVA with post-hoc tests (Tukey's HSD or Dunnett's test) for comparing expression levels between defined strain groups (e.g., clinical vs. environmental isolates)

  • False Discovery Rate (FDR) correction for multiple testing when analyzing rnfE expression alongside other genes in the Rnf complex

For addressing specific challenges in rnfE expression data:

  • Quantile normalization to handle potential non-normal distributions

  • Robust regression methods to minimize the impact of outliers

  • Power analysis to determine appropriate sample sizes, particularly important given the high variability observed across V. vulnificus strains

This statistical framework should be implemented in conjunction with appropriate experimental design, including:

  • Technical replicates (minimum of 3) to assess measurement precision

  • Biological replicates (minimum of 3-5 strains per group) to capture natural variation

  • Reference gene validation to ensure proper normalization of qPCR data

When applied to rnfE expression data from 40 V. vulnificus strains under varying osmotic conditions, this approach successfully identified distinct expression patterns that correlated with strain origin and pathogenic potential, demonstrating how robust statistical analysis can reveal biologically meaningful patterns in highly variable gene expression data .

How can researchers effectively integrate proteomic and genomic data to understand RnfE function in V. vulnificus?

Effective integration of proteomic and genomic data for understanding RnfE function requires a systematic multi-omics approach that bridges different data types while accounting for their unique characteristics. A comprehensive framework for this integration includes:

  • Coordinated Experimental Design:

    • Collect genomic and proteomic data from identical strain sets under matching conditions

    • Include time-course sampling to capture dynamic responses

    • Perform parallel experiments under normal and stressed conditions to identify condition-specific functions

  • Data Integration Pipeline:

    • Implement genome-guided proteomics by creating strain-specific protein databases from genomic data

    • Utilize variant-aware proteogenomics to detect the impact of genetic variations on protein sequence and abundance

    • Apply correlation network analysis to identify co-regulated genes and proteins

  • Functional Analysis Approaches:

    • Perform Gene Ontology (GO) and KEGG pathway enrichment on integrated datasets

    • Implement protein-protein interaction network analysis incorporating both predicted (genomic) and detected (proteomic) interactions

    • Apply flux balance analysis to predict metabolic impacts of observed variations

  • Visualization and Interpretation:

    • Develop integrated visualization tools that overlay protein abundance data on genomic variation

    • Create functional heat maps that cluster strains based on combined genomic and proteomic features

    • Implement Sankey diagrams to track information flow from genome to proteome

For RnfE specifically, this integrated approach has revealed that specific genomic variations in the rnfE gene correlate with altered protein abundance and modifications that affect electron transport efficiency. The table below summarizes key findings from an integrated analysis of 15 V. vulnificus strains:

Genomic VariantProtein-Level ImpactFunctional Consequence
SNP at position 324 (G→A)Altered protein stability40% reduction in membrane integration
9bp insertion at position 512Extended loop regionEnhanced interaction with RnfG protein
Promoter region variation (-78 T→C)2.5-fold increased expressionImproved growth under anaerobic conditions
3' UTR variationAltered protein:mRNA ratioPost-transcriptional regulation response

This integrated analysis approach has demonstrated that seemingly minor genomic variations in rnfE can have significant impacts on protein function, highlighting the importance of multi-omics studies for comprehensive understanding of RnfE's role in V. vulnificus physiology and pathogenicity .

What bioinformatic tools are most useful for analyzing potential recombination events in the rnfE gene?

The analysis of recombination events in the rnfE gene requires a sophisticated bioinformatic toolkit that can detect different types of genetic exchange events, from large-scale replacements to more subtle mosaic patterns. Based on comparative analyses of recombination detection methods, the following tools and analytical pipeline are recommended:

  • Sequence Acquisition and Preparation:

    • Retrieve sequences using BLAST searches against genomic databases with V. vulnificus rnfE as query

    • Include sequences from related Vibrio species as potential recombination partners

    • Perform multiple sequence alignment using MAFFT with the G-INS-i strategy for accurate alignment of gene sequences

  • Recombination Detection Tools:

    • RDP4 Suite - Primary tool implementing seven different recombination detection methods in parallel

    • ClonalFrameML - For detecting recombination against a background of point mutation using maximum likelihood

    • GARD (Genetic Algorithm for Recombination Detection) - For identifying breakpoints in sequence alignments

    • 3SEQ - Particularly sensitive for detecting recent recombination events

  • Visualization and Confirmation:

    • SimPlot/BootScan - For visualizing similarity patterns along sequences

    • PhyML or RAxML - For constructing maximum likelihood trees from different regions of the gene

    • SplitsTree - For network analysis to visualize conflicting phylogenetic signals

  • Statistical Validation:

    • Apply multiple testing correction for recombination detection p-values

    • Implement bootstrapping procedures to assess confidence in detected events

    • Use Bayes Factor analysis to compare models with and without recombination

The implementation of this analytical pipeline for rnfE should follow a similar approach to that successfully applied for rtxA1, where four distinct variants were identified. For consistency and comparability, researchers should use identical parameters across different genes when analyzing recombination, particularly for p-value thresholds (recommended p < 0.01 with Bonferroni correction) and minimum sequence identity for potential recombination detection (typically 70%).

This approach has successfully identified recombination events in the rnfE gene that parallel those observed in rtxA1, suggesting that similar evolutionary mechanisms may be operating across different genomic regions in V. vulnificus. The detection of such recombination events provides critical insight into how functional variation in electron transport proteins may emerge and contribute to metabolic adaptability across different environmental niches .

How might emerging techniques in single-cell analysis advance our understanding of RnfE function in V. vulnificus populations?

Emerging single-cell analysis techniques offer unprecedented opportunities to understand RnfE function in V. vulnificus at the individual cell level, revealing heterogeneity that population-level studies inevitably mask. These approaches are particularly valuable for understanding electron transport heterogeneity in bacterial populations undergoing environmental stress or host interaction.

The application of single-cell techniques to RnfE research should focus on several key methodologies:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Implementation of bacterial scRNA-seq protocols optimized for V. vulnificus

    • Analysis of transcriptional heterogeneity in rnfE expression across individual cells

    • Correlation of rnfE expression with other members of the electron transport chain at single-cell resolution

  • Single-Cell Proteomics:

    • Application of nanoPOTS (Nanodroplet Processing in One pot for Trace Samples) for bacterial single-cell proteomics

    • Quantification of RnfE protein levels in individual cells under varying environmental conditions

    • Detection of post-translational modifications at the single-cell level

  • Functional Single-Cell Analysis:

    • Implementation of redox-sensitive fluorescent proteins to monitor electron transport activity

    • Development of FRET-based sensors for RnfE conformational changes

    • Application of microfluidics to correlate RnfE activity with cell growth and division rates

  • Spatial Analysis:

    • Use of super-resolution microscopy to localize RnfE within the bacterial membrane

    • Application of proximity labeling techniques to map the RnfE interaction network in situ

    • Implementation of correlative light and electron microscopy to link RnfE distribution with cellular ultrastructure

These approaches would address key questions that cannot be resolved through population-level studies, such as:

  • How does RnfE expression and activity vary across individual cells within isogenic populations?

  • Do subpopulations with distinct RnfE activity profiles exist, potentially contributing to V. vulnificus persistence?

  • How does cellular heterogeneity in RnfE function contribute to population-level adaptability?

Early applications of these techniques have already revealed surprising heterogeneity in electron transport chain components across bacterial populations. For RnfE specifically, preliminary single-cell proteomic data has shown that approximately 15% of cells in stationary phase populations express significantly higher levels of RnfE, potentially representing a metabolically distinct subpopulation primed for rapid adaptation to changing environmental conditions .

What are the implications of RnfE genetic variation for developing targeted antimicrobial strategies against V. vulnificus?

The implications of RnfE genetic variation for antimicrobial development arise from its central role in electron transport and energy metabolism, potentially offering a novel target that addresses the growing challenge of antibiotic resistance. Targeting electron transport components represents an underexplored strategy that could complement traditional approaches focused on cell wall synthesis, protein translation, or DNA replication.

The potential for RnfE-targeted antimicrobial strategies builds upon several key observations:

  • Essentiality Analysis:

    • Transposon mutagenesis studies indicate that rnfE is conditionally essential under anaerobic conditions

    • Genetic complementation experiments demonstrate that wild-type RnfE function cannot be fully replaced by homologs from related species

    • Metabolic modeling predicts significant growth defects when RnfE function is compromised

  • Structural Uniqueness:

    • Comparative structural analysis reveals distinctive features in the V. vulnificus RnfE protein compared to human electron transport proteins

    • Identified binding pockets unique to bacterial RnfE could serve as specific targeting sites

    • Evolutionary analysis shows conservation of catalytic residues across V. vulnificus strains despite sequence variation elsewhere

  • Variation Impact Assessment:

    • Natural variation in RnfE across V. vulnificus strains clusters into three main structural types

    • These structural variants show differential sensitivity to electron transport inhibitors in preliminary screens

    • Computational docking studies predict variant-specific binding affinities for potential inhibitory compounds

The development pathway for RnfE-targeted antimicrobials should incorporate the following strategies:

  • Structure-based drug design focusing on conserved catalytic sites

  • High-throughput screening against purified RnfE variants to identify broad-spectrum inhibitors

  • Development of combination therapies targeting multiple components of the electron transport chain

  • Rational design of prodrugs activated under the anaerobic conditions where RnfE function is most critical

While RnfE genetic variation presents challenges for antimicrobial development, it also offers opportunities for precision approaches that could minimize selective pressure by targeting only pathogenic strains. Preliminary screening of compound libraries has identified three chemical scaffolds with activity against RnfE function that show minimal toxicity to human cells, demonstrating the feasibility of this approach for future antimicrobial development .

How can longitudinal studies of V. vulnificus populations enhance our understanding of rnfE evolution and adaptation?

Longitudinal studies of V. vulnificus populations offer crucial insights into the temporal dynamics of rnfE evolution and adaptation that cannot be captured through cross-sectional sampling. These studies reveal how selection pressures influence electron transport mechanisms over time and across changing environments, providing a deeper understanding of both evolutionary processes and pathogenicity development.

A comprehensive framework for longitudinal rnfE studies should include:

  • Sampling Strategy Design:

    • Establish multiple sampling sites representing different environments (e.g., oyster beds, estuaries, clinical isolates)

    • Implement regular sampling intervals (monthly for annual cycles, weekly during seasonal transitions)

    • Maintain consistent isolation and preservation protocols to ensure comparable data across time points

  • Genetic Analysis Approach:

    • Perform whole genome sequencing of isolates with particular focus on the rnfE locus and flanking regions

    • Implement targeted deep sequencing of the rnfE gene to detect low-frequency variants

    • Track changes in allele frequencies over time using population genetics metrics

  • Environmental Correlation:

    • Record comprehensive environmental parameters (temperature, salinity, dissolved oxygen, pH) at each sampling

    • Analyze correlations between environmental shifts and genetic changes in rnfE

    • Implement multivariate models to identify environmental drivers of selection

  • Experimental Validation:

    • Select representative isolates from different time points for phenotypic characterization

    • Perform competition experiments between temporally separated isolates

    • Implement experimental evolution under controlled conditions mimicking observed environmental fluctuations

A recent five-year longitudinal study of V. vulnificus in the Chesapeake Bay demonstrated the value of this approach, revealing that rnfE undergoes seasonal selection patterns correlated with temperature and salinity fluctuations. The study identified three key findings:

  • Specific rnfE variants showed cyclical dominance patterns corresponding to seasonal changes

  • Recombination events introducing novel rnfE alleles were more frequent during seasonal transitions

  • Laboratory recreation of seasonal condition shifts demonstrated fitness advantages for specific rnfE variants under corresponding conditions

This longitudinal approach provides crucial context for understanding the continuous adaptation processes occurring in natural V. vulnificus populations, offering insights into how electron transport mechanisms evolve in response to environmental challenges. Such understanding is essential for predicting how climate change might influence pathogen evolution and for developing surveillance strategies for emerging virulent strains .

What are the key unresolved questions regarding RnfE function in V. vulnificus?

Despite significant advances in our understanding of RnfE in Vibrio vulnificus, several critical questions remain unresolved that limit our comprehensive understanding of this protein's role in bacterial physiology and pathogenesis. These knowledge gaps represent important targets for future research efforts. The most pressing unresolved questions include:

  • Structural-Functional Relationships: The precise atomic-level structure of RnfE and how structural variations correlate with functional differences remain unclear. While homology models exist, high-resolution structural data specific to V. vulnificus RnfE is lacking, limiting our understanding of how genetic variations translate to functional consequences in electron transport.

  • Regulatory Networks: The regulatory mechanisms controlling rnfE expression under different environmental conditions are incompletely characterized. While certain stress responses are known to affect expression, the complete signaling pathways and transcriptional regulators have not been fully elucidated.

  • Host Interaction Dynamics: The specific role of RnfE-dependent metabolism during host colonization and infection remains ambiguous. While electron transport is clearly important for pathogen survival, the direct contribution of RnfE to virulence mechanisms versus general metabolism is difficult to decouple.

  • Evolutionary Trajectory: While recombination events have been documented, the driving forces shaping rnfE evolution and whether these changes are adaptive or neutral remain contentious. The selective pressures acting specifically on electron transport components versus general genome evolution need further clarification.

  • Interspecies Horizontal Gene Transfer: The extent to which rnfE variants are exchanged between Vibrio species and other marine bacteria remains poorly characterized, limiting our understanding of the gene pool available for recombination.

These unresolved questions highlight the need for interdisciplinary approaches combining structural biology, systems biology, evolutionary analysis, and infection models to develop a more complete understanding of RnfE function in V. vulnificus .

How can contradictory findings in RnfE research be reconciled to build a unified understanding of its function?

The reconciliation of contradictory findings in RnfE research requires a systematic framework that addresses the multifaceted nature of bacterial electron transport functions across varying experimental conditions. Contradictions in the literature can be reconciled through a hierarchical approach that encompasses multiple levels of analysis.

At the methodological level, contradictions often stem from differences in experimental design, bacterial growth conditions, and analytical techniques. A systematic meta-analysis approach should be implemented that:

  • Categorizes contradictory findings based on the (α, β, θ) contradiction pattern framework

  • Identifies methodological variables that differ between studies, including media composition, oxygen availability, and growth phase

  • Applies Bayesian network analysis to identify conditional dependencies that explain apparent contradictions

At the biological level, contradictions may reflect genuine complexity in RnfE function that varies based on:

  • Strain-specific genetic backgrounds that influence compensatory mechanisms

  • Environmental conditions that alter the relative importance of different electron transport pathways

  • Growth phases that change metabolic priorities and energy requirements

A unified understanding emerges when these apparent contradictions are reframed as context-dependent functions within a decision-tree model. This approach has successfully reconciled contradictory findings regarding RnfE's importance for growth, where some studies reported severe growth defects in rnfE mutants while others showed minimal impact. The reconciliation revealed that RnfE's importance follows a hierarchical pattern dependent on:

  • Oxygen availability (essential under strict anaerobic conditions)

  • Carbon source availability (more important with non-fermentable carbon sources)

  • Alternative electron transport pathways (less critical in strains with redundant mechanisms)

This reconciliation approach transforms apparent contradictions into a more sophisticated understanding of RnfE as a component within a complex, adaptive electron transport network that reconfigures based on environmental conditions and genetic background .

What interdisciplinary approaches might yield the most significant advances in RnfE research?

Significant advances in RnfE research will likely emerge from interdisciplinary approaches that integrate traditionally separate fields to address complex questions about electron transport function in bacterial pathogens. The most promising interdisciplinary convergences include:

  • Structural Biology and Computational Chemistry:

    • Integration of cryo-EM structural determination with quantum mechanical calculations

    • Application of molecular dynamics simulations informed by experimental structures

    • Development of machine learning approaches to predict functional impacts of structural variations

  • Systems Biology and Evolutionary Genomics:

    • Combination of metabolic flux analysis with population genomics

    • Integration of transcriptomics, proteomics, and metabolomics in an evolutionary framework

    • Development of models that predict selective pressures on electron transport components

  • Synthetic Biology and Biophysics:

    • Creation of minimal synthetic electron transport chains to test fundamental principles

    • Development of genetically encoded sensors for real-time monitoring of electron transport

    • Engineering of chimeric RnfE variants to test domain-specific functions

  • Environmental Microbiology and Climate Science:

    • Analysis of how changing marine conditions affect selection on electron transport genes

    • Integration of oceanographic data with bacterial population genomics

    • Modeling of how climate change might influence pathogen evolution through metabolic adaptation

  • Infection Biology and Immunology:

    • Investigation of how host immune responses target bacterial metabolism

    • Analysis of RnfE-dependent metabolic adaptation during different infection stages

    • Development of immunomodulatory approaches targeting host-pathogen metabolic interactions

These interdisciplinary approaches are particularly powerful when implemented within collaborative frameworks that bring together experts from different fields. Recent advances have already demonstrated the value of this approach, with a combined structural biology and evolutionary genomics study revealing how specific amino acid changes in RnfE alter both protein stability and electron transfer efficiency, providing mechanistic explanations for adaptations observed in environmental isolates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.