Recombinant Vibrio vulnificus Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; VV3099; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
frdC
Target Protein Sequence
MSNRKPYVREVKRTWWKDHPFYRFYMLREATVLPLILFTLFLTVGLGSLVKGPEAWQTWL NFMANPVVIAINIVALLGSLLHAHTFFSMMPQVMPIRLKGKPVDKKIIVLAQWAAVAFIS LIVLIVV
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links

KEGG: vvy:VV3099

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does frdC contribute to bacterial metabolism in Vibrio vulnificus?

The frdC protein (also known as VV3099, Quinol-fumarate reductase subunit C, or QFR subunit C) plays a critical role in anaerobic respiration by enabling V. vulnificus to utilize fumarate as a terminal electron acceptor when oxygen is limited. This metabolic capability may be particularly important during:

  • Growth in oxygen-depleted marine or estuarine environments

  • Biofilm formation where oxygen gradients exist

  • Host colonization where tissue environments may become anaerobic

  • Stress response to changing environmental conditions

The ability to perform anaerobic respiration provides metabolic flexibility that likely contributes to the ecological success and virulence potential of this pathogen .

What is known about the genetic organization of the frd operon in Vibrio vulnificus?

While the search results don't specifically detail the frd operon structure in V. vulnificus, it likely follows the typical bacterial organization of frdABCD, encoding the four subunits of the fumarate reductase complex. The frdC gene encodes the membrane-anchoring C subunit with a UniProt ID of Q7MGX5. Similar to other Vibrio species, the expression of metabolic genes like frdC may be subject to regulation by global regulatory systems responding to environmental conditions, potentially including non-coding RNAs as seen with other Vibrio virulence factors .

How might genetic variation in frdC affect Vibrio vulnificus virulence?

Studies on V. vulnificus have demonstrated that genetic recombination events can significantly impact virulence factors. For example, research on the rtxA1 gene revealed four distinct variants that arose through recombination with other sources, resulting in toxins with different arrangements of effector domains and varying potency . While specific information about frdC recombination is not provided in the search results, similar genetic plasticity might be expected.

To study potential frdC variation:

  • Sequence the frdC gene from diverse clinical and environmental isolates

  • Analyze expression levels under infection-relevant conditions

  • Assess the impacts of any variations on protein function and virulence

  • Create isogenic mutants with different frdC variants to compare phenotypes

The evolutionary pressure on metabolic genes like frdC might differ from that on classical virulence factors, potentially favoring conservation of function while allowing sequence diversity .

What experimental approaches are most effective for studying frdC interactions with other fumarate reductase complex components?

To study the protein interactions of frdC with other components of the fumarate reductase complex:

TechniqueApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo protein interaction screeningWorks in bacterial system, allows high-throughput screeningMay produce false positives/negatives with membrane proteins
Co-immunoprecipitationVerification of protein-protein interactionsDetects native complexesRequires optimization of detergent conditions for membrane proteins
Surface plasmon resonanceQuantitative binding kineticsProvides Ka/Kd values, real-time analysisRequires purified proteins in suitable detergent/lipid environments
Cryo-electron microscopyStructural analysis of the complexCan resolve atomic-level interactionsTechnically challenging with membrane proteins
Cross-linking mass spectrometryIdentification of interaction interfacesMaps specific contact pointsMay capture non-physiological interactions

For membrane proteins like frdC, maintaining an appropriate membrane-mimicking environment during purification and analysis is critical to preserving native-like interactions and function .

How might frdC contribute to the adaptation of Vibrio vulnificus to different host and environmental conditions?

V. vulnificus encounters diverse environments throughout its lifecycle, from marine/estuarine habitats to human hosts during infection. The fumarate reductase complex containing frdC likely plays a key role in adaptation to oxygen-limited conditions within these varied niches.

Recent research on Vibrio species has highlighted the importance of metabolic flexibility in virulence. For example, V. cholerae utilizes different regulatory systems that connect metabolism to virulence gene expression . Similarly, frdC-dependent anaerobic respiration may contribute to V. vulnificus pathogenicity by:

  • Enabling survival in oxygen-depleted infection sites

  • Supporting growth under the limited-oxygen conditions found in biofilms

  • Contributing to persistence in sediments and shellfish

  • Allowing metabolic adaptation during host-to-environment transitions

Understanding these adaptations requires examining frdC expression and function across environmentally relevant conditions using techniques like RNA-seq, proteomics, and metabolic flux analysis .

What might be the relationship between frdC and established virulence factors in Vibrio vulnificus?

While the direct relationship between frdC and classical virulence factors is not explicitly covered in the search results, research on other Vibrio species suggests potential connections between metabolism and virulence. In V. parahaemolyticus, for example, the loss of Hfq (an RNA chaperone that facilitates sRNA-mRNA interactions) affects the expression of virulence factors like the Type III Secretion System (T3SS) .

Potential relationships could include:

  • Shared regulatory networks responding to environmental cues

  • Metabolic dependencies where virulence factor production requires energy generated through pathways involving fumarate reductase

  • Coordinated expression during specific stages of infection

  • Indirect effects where metabolic activity influences the cellular environment needed for virulence factor function

Investigation of these relationships would require comparative genomics, transcriptomics of wild-type versus frdC mutants, and metabolic analysis during infection .

What are the optimal conditions for expressing and purifying recombinant Vibrio vulnificus frdC?

Based on the recombinant protein described in the search results, successful expression of V. vulnificus frdC has been achieved with the following specifications:

ParameterOptimal ConditionNotes
Expression SystemE. coliStandard host for recombinant protein production
Fusion TagN-terminal His tagFacilitates purification while minimizing functional interference
Protein LengthFull Length (1-127)Complete sequence without truncation
FormLyophilized powderStable format for storage
Purity>90% (by SDS-PAGE)Suitable for most research applications
Storage BufferTris/PBS-based with 6% Trehalose, pH 8.0Trehalose enhances stability of membrane proteins
ReconstitutionSterile water to 0.1-1.0 mg/mL with 5-50% glycerolGlycerol prevents aggregation
Storage-20°C/-80°C, avoid repeated freeze-thawAliquoting recommended

For membrane proteins like frdC, additional considerations for successful expression and purification include:

  • Using specialized E. coli strains designed for membrane protein expression

  • Induction at lower temperatures (16-20°C) to improve proper folding

  • Careful selection of detergents for membrane extraction

  • Step-wise purification including IMAC followed by size-exclusion chromatography

What methods can be used to assess the functional activity of recombinant frdC?

Since frdC functions as the membrane anchor of the fumarate reductase complex rather than containing the catalytic site itself, functional assessment requires approaches that evaluate its proper membrane insertion and complex assembly:

  • Membrane Integration Assays:

    • Protease protection assays to confirm proper membrane topology

    • Fluorescence-based techniques to monitor membrane insertion

    • Sucrose gradient fractionation to verify membrane association

  • Complex Assembly Assessment:

    • In vitro reconstitution with other fumarate reductase subunits

    • Co-purification with partner proteins when co-expressed

    • Analytical ultracentrifugation to verify complex formation

  • Indirect Functional Assays:

    • Complementation of frdC deletion mutants

    • Growth restoration under anaerobic conditions

    • Enzyme activity reconstitution when combined with other subunits

  • Structural Verification:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to confirm proper folding

    • Negative-stain electron microscopy of reconstituted complexes

How can genetic manipulation techniques be applied to study frdC function in Vibrio vulnificus?

Several genetic approaches can be employed to investigate frdC function:

  • Gene Deletion/Knockout:
    Create clean deletions of frdC using homologous recombination or CRISPR-Cas9 systems to assess its importance for growth under various conditions and for virulence in infection models.

  • Site-Directed Mutagenesis:
    Introduce specific amino acid changes to identify residues critical for membrane insertion, protein-protein interactions, or complex stability.

  • Reporter Fusions:
    Create transcriptional (promoter-reporter) or translational (protein-reporter) fusions to monitor frdC expression and regulation under different environmental conditions.

  • Complementation Studies:
    Reintroduce wild-type or mutant versions of frdC into knockout strains to confirm phenotypes and investigate structure-function relationships.

  • Chromosomal Tagging:
    Add epitope tags or fluorescent protein fusions to the chromosomal copy of frdC to study protein localization, dynamics, and interactions in living cells.

Research on V. vulnificus has demonstrated the feasibility of these genetic approaches, as similar techniques have been successfully applied to study virulence factors like the rtxA1 gene .

What experimental design considerations are important when investigating the role of frdC in Vibrio vulnificus pathogenesis?

When designing experiments to study frdC's role in pathogenesis, researchers should consider:

  • Strain Selection:

    • Include both clinical and environmental isolates

    • Consider strains from different lineages (I and II) as described in research on rtxA1

    • Use appropriate reference strains with well-characterized virulence

  • Growth Conditions:

    • Compare aerobic versus anaerobic/microaerobic conditions

    • Include conditions that mimic host environments (temperature, pH, nutrient availability)

    • Consider biofilm versus planktonic growth states

  • Infection Models:

    • Select models relevant to natural infection routes (e.g., gastrointestinal)

    • Use quantitative infection approaches as described for MARTX Vv toxin studies

    • Include both in vitro cell culture and in vivo animal models

  • Control Comparisons:

    • Include isogenic mutants differing only in frdC

    • Use complemented strains to confirm phenotypes

    • Compare with mutants in known virulence factors

  • Comprehensive Analysis:

    • Combine multiple approaches (genetics, biochemistry, structural biology)

    • Assess both direct (protein function) and indirect (metabolic, regulatory) effects

    • Consider potential redundancy in metabolic pathways

These considerations will help establish clear connections between frdC function and pathogenesis, avoiding confounding factors that could complicate interpretation .

How can high-throughput screening approaches be adapted to study frdC interactions with potential inhibitors?

For researchers interested in identifying inhibitors of frdC function, several high-throughput screening approaches can be adapted:

  • Bacterial Growth Inhibition Assays:

    • Screen for compounds that selectively inhibit growth under anaerobic conditions

    • Compare growth inhibition between wild-type and frdC mutant strains to identify frdC-specific inhibitors

    • Use 96/384-well plate formats with automated readouts for high throughput

  • Protein-Based Screening:

    • Develop binding assays using purified frdC protein

    • Apply thermal shift assays to identify compounds that stabilize or destabilize the protein

    • Utilize surface plasmon resonance to quantify binding interactions

  • Complex Assembly Interference:

    • Screen for compounds that disrupt the assembly of the fumarate reductase complex

    • Use FRET-based assays to monitor protein-protein interactions in the presence of inhibitors

    • Apply split-reporter systems that produce signal only when complex formation occurs

  • In Silico Approaches:

    • Use the amino acid sequence provided to generate structural models

    • Perform virtual screening of compound libraries against potential binding pockets

    • Apply molecular dynamics simulations to predict compound effects on protein stability

  • Whole-Cell Reporter Systems:

    • Develop bacterial biosensors that report on frdC function or expression

    • Create conditional growth selection systems dependent on fumarate reductase activity

    • Implement fluorescence-based sorting to identify cells with altered frdC function

These approaches provide a foundation for identifying compounds that could serve as chemical probes for studying frdC function or potentially as leads for antimicrobial development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.