Recombinant Vibrio vulnificus Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Functional Role of MsbA

MsbA is an ATP-binding cassette (ABC) transporter responsible for flipping lipid A (a component of lipopolysaccharide, LPS) from the cytoplasmic to the periplasmic leaflet of the inner membrane. This process is essential for outer membrane biogenesis and bacterial viability . In V. vulnificus, lipid A is a key virulence factor, contributing to septicemia and wound infections in immunocompromised hosts .

Key functions:

  • Lipid A transport: Maintains asymmetric LPS distribution critical for membrane integrity .

  • Antibiotic target: Essential for bacterial survival, making it a candidate for novel antimicrobial therapies .

Recombinant Expression and Applications

Recombinant MsbA is typically expressed in E. coli with affinity tags (e.g., His-tag) for purification. Example specifications from Rhodoferax ferrireducens MsbA (Q21WN9) provide a template :

ParameterDetail
Source organismRhodoferax ferrireducens (homolog of V. vulnificus MsbA)
Expression hostE. coli
Protein length581 amino acids
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)

This system enables structural studies, inhibitor screening, and functional assays to probe lipid A transport mechanisms .

4.1. Antibiotic Resistance and Pathogenesis

  • V. vulnificus strains often carry multiple antibiotic resistance genes (ARGs), including those mediating β-lactam and tetracycline resistance . MsbA’s role in LPS assembly indirectly influences resistance by maintaining membrane impermeability.

  • Deletion of msbA homologs in V. cholerae and S. typhimurium disrupts LPS transport, leading to cell death .

4.2. Genomic Context in V. vulnificus

  • Genomic studies of V. vulnificus highlight pathogenicity islands encoding virulence factors like cytolysins (VvhA) and metalloproteases (VvpE) . Though MsbA is not directly linked to these islands, its function in LPS trafficking supports systemic infection .

  • Phylogenetic analysis reveals V. vulnificus strains cluster into lineages with varied environmental and clinical prevalence, suggesting MsbA’s conservation across genotypes .

Future Directions

  • Structural characterization: Cryo-EM studies of V. vulnificus MsbA could reveal species-specific transport dynamics.

  • Therapeutic targeting: High-throughput screening of MsbA inhibitors may yield novel antibiotics against multidrug-resistant V. vulnificus .

  • Horizontal gene transfer: Investigating mobile genetic elements near msbA could elucidate resistance/virulence gene co-evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
msbA; VV2357; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
msbA
Target Protein Sequence
MSINTDESTWRTFKRLWTFIRLYKSGLAVAVVALIINAVSDTYMVSLLKPLLDEGFGSAE SDFLRTLPLLVFGLMFIRGISSFVSTYCLSWVSGNVVMQVRRMVFNHYMQMPVSYFDKEK SGSLLSRITYDSEQVSAATSQALVSIVREGTSIIGLLVLMFYNSWQLSLVLILVAPVVAW AIGFVSKRFRKISKNMQTTMGIVTSSAEQMLKGHKVVLSYGGQEVEKSRFDVVSNQMRQQ SMKLITAQAAANPIIQMIASIAIVVVLYLASVDTIKDQLTPGTFTVVFSAMFGLMRPLKA LTNVTSQFQRGMAAAQTLFALVDLEPEKNTGTYSVERAKGEVNVKDISFTYEGAEKPALS HVSFDIPRGKTVALVGRSGSGKSTIANLFTRFYDVDSGEIQLDGVDVRDYELKNLRTQFA LVSQNVHLFNDTIANNIAYAAGDKYSREDIERAAELAHAMEFISKMENGLDTVVGENGAS LSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQSALDELQKNKTVLVIAHRLS TIEKADQILVIDDGAVVERGSHSELIEKDGAYAQLHRIQFGEG
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy provision.
Database Links

KEGG: vvy:VV2357

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MsbA protein in Vibrio vulnificus?

MsbA in Vibrio vulnificus functions as an essential ATP-binding cassette (ABC) transporter responsible for the export of lipid A from the inner to the outer membrane during lipopolysaccharide (LPS) biosynthesis. This transport process is critical for maintaining cell envelope integrity and bacterial survival. In pathogenic bacteria like V. vulnificus, proper LPS assembly is directly linked to virulence potential, as LPS is a key component of the outer membrane and contributes significantly to pathogenicity and immune evasion mechanisms .

How does MsbA structure relate to its function in transport mechanisms?

MsbA is a full-length protein consisting of transmembrane domains and nucleotide-binding domains. The protein typically contains approximately 583 amino acids arranged in a structure that facilitates ATP-dependent flipping of lipid substrates across the membrane. The transmembrane helices form a chamber that accommodates lipid substrates, while the nucleotide-binding domains harness energy from ATP hydrolysis to drive conformational changes required for transport. This structure-function relationship enables MsbA to act as a molecular machine that translocates lipid A across the cytoplasmic membrane .

What are the key differences between MsbA in Vibrio vulnificus and other bacterial species?

While the core function of MsbA is conserved across bacterial species, V. vulnificus MsbA exhibits specific sequence variations that may correlate with its adaptation to marine environments and pathogenicity in both aquatic animals and humans. Comparative genome analysis between different Vibrio strains reveals variations in the genetic regions associated with LPS and capsular polysaccharide synthesis, which likely influence the substrate specificity of the MsbA transporter. These specific adaptations may contribute to the notable virulence of certain V. vulnificus strains, particularly in the most virulent isolates like SUKU_G1 .

What expression systems are most effective for recombinant V. vulnificus MsbA production?

For optimal expression of functional recombinant V. vulnificus MsbA, E. coli-based expression systems are frequently employed. The typical approach involves cloning the msbA gene from V. vulnificus into expression vectors containing N-terminal or C-terminal affinity tags (commonly His-tags) for purification purposes. For membrane proteins like MsbA, E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) typically yield better results than standard BL21(DE3) strains. Expression conditions should be carefully optimized, with induction typically performed at lower temperatures (16-20°C) to facilitate proper folding of this complex membrane protein .

What purification protocol provides the highest yield of functional MsbA protein?

A recommended purification protocol for His-tagged MsbA includes:

  • Cell lysis using either mechanical disruption or detergent-based methods

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (typically DDM, LMNG, or UDM)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

  • Size exclusion chromatography for final purification and buffer exchange

During purification, maintaining protein stability requires buffer compositions containing 0.02-0.05% detergent, glycerol (typically 10%), and ATP/Mg²⁺ to stabilize the nucleotide-binding domains. Final preparations should be aliquoted and stored with cryoprotectants like 6% trehalose to preserve activity during freeze-thaw cycles .

How can researchers verify the functionality of purified recombinant MsbA?

Functional verification of purified recombinant MsbA can be accomplished through multiple assays:

  • ATPase activity assays to confirm ATP hydrolysis capabilities

  • Lipid flippase assays using fluorescently labeled lipid analogs

  • Reconstitution into proteoliposomes followed by transport assays

  • Thermostability assays to assess proper folding

  • Circular dichroism spectroscopy to confirm secondary structure composition

Functional MsbA should demonstrate ATP-dependent transport activity with appropriate lipid substrates. When interpreting results, it's important to consider that contradictory findings may emerge from different assay formats, necessitating the use of multiple complementary techniques to build a comprehensive understanding of protein functionality .

How can researchers investigate the relationship between MsbA function and V. vulnificus virulence?

To investigate the relationship between MsbA function and V. vulnificus virulence, researchers can employ a multi-faceted approach:

  • Generate conditional or temperature-sensitive msbA mutants in V. vulnificus

  • Perform comparative virulence studies using animal models with different V. vulnificus strains expressing variant MsbA proteins

  • Analyze LPS profiles from wild-type and mutant strains

  • Conduct transcriptomic analyses to identify genes co-regulated with msbA under different conditions

  • Implement site-directed mutagenesis to identify critical residues for MsbA function

Animal infection studies have demonstrated that different V. vulnificus strains (such as SUKU_G1, SUKU_G2, and SUKU_G3) exhibit significantly different virulence profiles, which may correlate with variations in LPS structure and transport efficiency. When designing such experiments, researchers should carefully consider inoculum size, as demonstrated in mouse models where survival rates varied dramatically based on bacterial load .

What structural techniques can elucidate the substrate binding mechanism of V. vulnificus MsbA?

Advanced structural biology techniques to investigate MsbA substrate binding include:

  • Cryo-electron microscopy (Cryo-EM) to capture different conformational states

  • X-ray crystallography of MsbA in complex with substrate analogs or inhibitors

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and substrate interaction sites

  • Molecular dynamics simulations to model substrate translocation pathways

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy

These approaches can capture the conformational changes associated with the transport cycle and identify specific residues involved in substrate recognition. The research should focus on how V. vulnificus MsbA might differ from better-characterized homologs in terms of substrate specificity and transport kinetics .

How do environmental conditions affect MsbA expression and function in V. vulnificus?

V. vulnificus is known to modify its membrane composition in response to environmental stressors such as temperature, salinity, and pH changes. Research into environmental regulation of MsbA should include:

  • qRT-PCR analysis of msbA expression under various environmental conditions

  • Reporter gene assays to visualize transcriptional regulation

  • Proteomics approaches to quantify MsbA protein levels

  • Functional assays comparing MsbA activity at different temperatures, pH values, and salt concentrations

  • In vivo membrane composition analysis correlated with MsbA expression levels

Comparisons between different V. vulnificus strains have shown varying growth capabilities and virulence profiles that may correlate with their ability to adapt to different environmental conditions. For instance, SUKU_G1 and SUKU_G3 exhibit faster growth rates than SUKU_G2, which may reflect differences in membrane transport efficiency under specific conditions .

What controls should be included when assessing MsbA inhibitors in antimicrobial development?

When evaluating potential MsbA inhibitors as antimicrobial agents, comprehensive controls should include:

Control TypePurposeImplementation
Positive controlVerify assay functionalityKnown MsbA inhibitors (e.g., NaN₃ for ATPase activity)
Negative controlEstablish baselineVehicle solution without inhibitor
Specificity controlConfirm target selectivityTesting against related ABC transporters
Cytotoxicity controlAssess non-specific effectsMammalian cell viability assays
Resistance developmentEvaluate potential for resistanceSerial passage experiments

Additionally, researchers should include both wild-type and mutant MsbA proteins with altered activity to establish a proper dynamic range for inhibition studies. Experiments should follow a dose-response format to determine IC₅₀ values accurately, and time-dependent inhibition profiles should be established to distinguish between competitive and non-competitive inhibition mechanisms .

How should researchers address conflicting data when studying MsbA function?

When confronted with contradictory results in MsbA research, follow this systematic approach:

  • Evaluate experimental conditions for potential variables affecting outcomes

  • Consider strain-specific differences in MsbA sequence and regulation

  • Implement multiple orthogonal techniques to verify findings

  • Design experiments that directly test competing hypotheses

  • Examine substrate specificity differences that might explain functional variations

Research has demonstrated that interpretation biases can significantly influence how scientists analyze the same dataset. When presenting complex or contradictory findings, researchers should explicitly acknowledge alternative interpretations and design follow-up experiments specifically aimed at resolving discrepancies. This approach not only improves scientific rigor but can lead to novel insights about MsbA function under different conditions .

What in vivo models are most appropriate for studying V. vulnificus MsbA in the context of pathogenesis?

Selecting appropriate in vivo models for V. vulnificus MsbA research requires careful consideration of the infection context:

  • Mouse models: Useful for studying systemic infection and septicemia, with carefully calibrated inoculum sizes (10³-10⁸ CFU) depending on the specific research question

  • Fish models: Particularly relevant for environmental strains affecting aquaculture, such as infections in brown marble groupers (Epinephelus fuscoguttatus)

  • Tissue culture systems: Human intestinal epithelial cell lines for studying host-pathogen interactions

  • Invertebrate models: Caenorhabditis elegans or Galleria mellonella as ethical alternatives for initial virulence screening

When designing animal experiments, researchers should carefully determine appropriate inoculum sizes based on preliminary studies. For example, in mouse models of V. vulnificus infection, inoculum sizes between 10³ and 10⁸ CFU have been used, with dramatic differences in survival rates observed at different bacterial loads. Additionally, properly timed sample collection is crucial, with blood samples typically taken between 30-120 minutes post-infection to track bacterial dissemination .

How should researchers interpret contradictory results in MsbA functional studies?

When faced with contradictory results in MsbA functional studies, researchers should:

  • Examine experimental conditions for variables that might explain differences, including detergent choice, lipid environment, and buffer composition

  • Consider strain-specific genetic variations in msbA that might impact function

  • Evaluate whether contradictions reflect different aspects of a complex molecular mechanism

  • Design experiments that directly test competing hypotheses rather than simply repeating previous work

  • Acknowledge confirmation bias and actively seek disconfirming evidence

Research has shown that scientists often interpret the same data differently based on their preconceptions. For example, when presented with correlation data that could be interpreted either positively or negatively, researchers were more than twice as likely to report detecting the correlation they expected. This underscores the importance of blinded analysis and collaborative interpretation when possible .

What bioinformatic approaches can identify functional domains in V. vulnificus MsbA?

Comprehensive bioinformatic analysis of V. vulnificus MsbA should include:

  • Multiple sequence alignment with homologs from different bacterial species to identify conserved regions

  • Domain prediction tools to map transmembrane regions, Walker A/B motifs, and signature sequences

  • Homology modeling based on crystal structures of MsbA from other species

  • Molecular dynamics simulations to predict conformational changes during transport cycle

  • Coevolution analysis to identify residue pairs likely involved in structural dynamics

Comparative genomic approaches have proven valuable in V. vulnificus research, revealing that the genome typically consists of two circular chromosomes (approximately 3 Mbp and 1.7 Mbp). Analysis of coding sequences across strains identified a core genome of approximately 3887 genes with an additional 1313 genes comprising the dispensable genome. This genomic plasticity likely contributes to functional variations in membrane proteins like MsbA across different strains .

How can transcriptomic data enhance understanding of MsbA regulation in V. vulnificus?

Transcriptomic analysis provides valuable insights into MsbA regulation within the broader context of V. vulnificus biology:

  • RNA-seq data can reveal co-regulated gene clusters involved in LPS biosynthesis and export

  • Differential expression analysis under various conditions can identify environmental triggers for msbA expression

  • Comparison between virulent and avirulent strains can highlight regulatory differences affecting MsbA production

  • Transcription start site mapping can elucidate promoter architecture and potential regulatory elements

  • Integration with proteomics data can identify post-transcriptional regulation mechanisms

When analyzing transcriptomic data, researchers should be mindful of strain-specific differences. For instance, comparative genomic analysis of V. vulnificus strains revealed significant variations in genes related to LPS and capsular polysaccharide synthesis between highly virulent (SUKU_G1) and less virulent or avirulent strains (SUKU_G2 and SUKU_G3). These differences likely influence the regulation and substrate specificity of membrane transporters like MsbA .

What are the optimal storage conditions for maintaining recombinant MsbA activity?

To maintain optimal activity of purified recombinant MsbA:

  • Store the purified protein at -20°C/-80°C in appropriate buffer conditions

  • Add cryoprotectants such as 6% trehalose or 10-20% glycerol to the storage buffer

  • Avoid repeated freeze-thaw cycles by creating single-use aliquots

  • For short-term storage (up to one week), maintain working aliquots at 4°C

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

The addition of glycerol (typically 5-50% final concentration) is particularly important for preserving protein structure during freezing. For optimal results, centrifuge vials briefly before opening to bring contents to the bottom, especially when working with lyophilized preparations .

How can researchers assess and prevent aggregation of purified MsbA?

Preventing and monitoring aggregation of purified MsbA requires:

  • Dynamic light scattering to detect early aggregation events

  • Size exclusion chromatography to quantify monomer/oligomer distribution

  • Addition of stabilizing agents such as specific lipids (phosphatidylethanolamine) or cholesterol hemisuccinate

  • Optimization of detergent concentration to maintain the critical micelle concentration (CMC)

  • Use of proper buffer systems (typically Tris/PBS-based buffers at pH 8.0) with stabilizing additives

For long-term stability, storage in detergent-lipid mixed micelles often proves superior to detergent micelles alone. Regular quality control testing should be implemented when using stored protein preparations, with functional assays performed to confirm retained activity prior to experimental use .

What emerging technologies might advance understanding of V. vulnificus MsbA?

Emerging technologies with significant potential for MsbA research include:

  • Single-molecule techniques to visualize transport cycles in real-time

  • Native mass spectrometry to analyze intact membrane protein complexes

  • Cryo-electron tomography to study MsbA in its native membrane environment

  • CRISPR-Cas9 genome editing for precise manipulation of msbA in V. vulnificus

  • Microfluidic systems to study MsbA function under controlled environmental gradients

These approaches will help address fundamental questions about MsbA's role in V. vulnificus pathogenesis and potentially identify novel strategies for therapeutic intervention targeting bacterial membrane biogenesis pathways.

How might collaborative research approaches resolve contradictions in the MsbA literature?

Addressing contradictions in the scientific literature requires collaborative approaches that:

  • Implement standardized protocols across laboratories

  • Establish shared reagent repositories (such as validated antibodies and bacterial strains)

  • Conduct multi-laboratory replication studies with blinded analysis

  • Create open-access databases of raw experimental data

  • Develop consensus methodological guidelines for MsbA functional studies

Historical analysis of scientific progress demonstrates that contradictions often serve as catalysts for paradigm shifts. Rather than viewing contradictory results as obstacles, researchers should recognize them as opportunities for deeper understanding. As noted in the literature, "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress" .

What therapeutic applications might emerge from V. vulnificus MsbA research?

Future therapeutic applications emerging from V. vulnificus MsbA research may include:

  • Development of MsbA inhibitors as novel antimicrobials against multi-drug resistant Vibrio strains

  • Design of subunit vaccines targeting exposed epitopes of LPS transport machinery

  • Creation of diagnostic tools based on MsbA activity or expression patterns

  • Biomarker development for rapid identification of highly virulent V. vulnificus strains

  • Environmental monitoring systems targeting MsbA-dependent processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.