Recombinant Vibrio vulnificus Maltose transport system permease protein malG (malG)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Vibrio vulnificus Maltose transport system permease protein MalG (malG) is a genetically engineered transmembrane protein critical for maltose and maltodextrin uptake in the pathogenic bacterium Vibrio vulnificus. This protein forms part of the ATP-binding cassette (ABC) transporter complex, which includes MalF, MalG, and MalK subunits, and interacts with periplasmic maltose-binding protein (MBP) to facilitate nutrient acquisition . Recombinant production enables biochemical and structural studies to elucidate its role in bacterial metabolism and pathogenesis.

Recombinant Production

The protein is expressed in E. coli with an N-terminal His-tag for purification :

ParameterSpecification
Expression SystemE. coli
TagN-terminal 10xHis
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C
ReconstitutionSterile water or glycerol-containing buffers

Functional Role in Maltose Transport

MalG collaborates with MalF and MalK to form the MalFGK2_2 complex, which couples ATP hydrolysis to substrate translocation . Key functional insights include:

  • Membrane Topology: Six TM helices position conserved motifs (e.g., EAA loop) for interactions with MalK and substrate binding .

  • Assembly Determinants: Cytoplasmic loops between TM4-TM5 and TM6-C-terminus are essential for MalFGK2_2 complex formation .

  • Substrate Specificity: MalG’s C-terminal region is critical for maltodextrin transport but dispensable for maltose uptake .

Research Findings from Mutagenesis Studies

Insertional mutagenesis revealed regions tolerant to structural perturbations and those critical for function :

Mutation SitePhenotypeFunctional Impact
Periplasmic Loop 3Retains maltose transport activityTolerates insertions; may mediate MBP interactions
EAA Motif (194–214)Abolishes transportDisrupts MalK binding and ATPase activity
C-terminal (Residues 250–296)Permits maltose but not maltodextrin transportRequired for larger substrate recognition
Cytoplasmic Loop 3Blocks complex assemblyPrevents MalF-MalG-MalK interactions

Pathogenic Implications

While MalG’s primary role is nutrient uptake, Vibrio vulnificus virulence factors like MARTX toxin and hemolysin are regulated by systems analogous to the maltose transporter . MalG may indirectly influence pathogenicity by:

  • Supporting iron acquisition via siderophores regulated by cAMP-CRP systems .

  • Enabling survival in low-iron host environments .

Applications in Research

Recombinant MalG is utilized to:

  1. Study ABC transporter mechanics and substrate specificity .

  2. Develop inhibitors targeting bacterial nutrient uptake .

  3. Investigate membrane protein folding and complex assembly .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type selection is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
malG; VVA0399; Maltose/maltodextrin transport system permease protein MalG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
malG
Target Protein Sequence
MAMVQGKSLKYRVWATHIALWAFLSMIIFPLLMIVAISFREGNFATGSLIPDNPSLEHWK LALGFSVTNADGSVTPPPFPVLTWLWNSVKVAGITSILIVALSTTSAYAFARLRFKGKET ILKAMMIFQMFPAVLALVALYALFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY FETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIGVVGEVPVASLLLSDV NSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLLAQRWLVGGLTAGGVKG
Uniprot No.

Target Background

Function
MalG is a component of the ABC transporter complex MalEFGK, involved in maltose/maltodextrin import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: vvy:VVA0399

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of malG in V. vulnificus?

MalG serves as an integral membrane component of the maltose/maltodextrin ABC transporter system in V. vulnificus. It functions as a transmembrane permease that forms part of the channel through which maltose and maltodextrins are transported into the bacterial cell. This transport system is critical for the bacterium's ability to utilize maltose as a carbon source, particularly in environments where this sugar is abundant, such as in the human gastrointestinal tract during infection. The protein works in concert with other components of the ABC transporter complex, including the maltose-binding protein and ATP-binding proteins, to facilitate active transport against concentration gradients.

How does malG contribute to V. vulnificus fitness and survival?

MalG contributes significantly to bacterial fitness by enabling V. vulnificus to utilize maltose and related carbohydrates as energy sources. This ability is particularly important in nutrient-limited environments and during host colonization. Similar to how the Fur-iron complex regulates various virulence and survival mechanisms in V. vulnificus , the maltose transport system likely plays a role in bacterial adaptation to different environments. The efficient acquisition and utilization of carbohydrates provide V. vulnificus with a competitive advantage, especially during the early stages of infection when establishing a foothold in host tissues.

What is known about the genetic organization of malG in the V. vulnificus genome?

The malG gene in V. vulnificus is part of the maltose/maltodextrin transport operon, which typically includes other genes involved in maltose transport and metabolism. While the search results don't specifically detail the genetic organization, research approaches similar to those used for the rtxA1 gene or the fur gene would be appropriate for studying malG. The gene is likely regulated by carbon catabolite repression systems and possibly influenced by environmental signals such as osmolarity and temperature, which are relevant to V. vulnificus's lifestyle as a marine and human pathogen.

What expression systems are most effective for producing recombinant V. vulnificus malG?

For membrane proteins like malG, E. coli-based expression systems often present challenges due to protein misfolding and toxicity. Researchers should consider using specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)), or alternative expression hosts like Pichia pastoris for eukaryotic-style processing. Expression strategies similar to those used for recombinant FlaB protein can be adapted for malG. The methodology would typically involve PCR amplification of the malG gene from V. vulnificus genomic DNA, cloning into an appropriate expression vector with a fusion tag (such as His6, GST, or MBP), and transformation into the expression host.

What are the main challenges in purifying functional recombinant malG, and how can they be overcome?

Purification of functional malG presents several challenges due to its hydrophobic nature and membrane localization. Key challenges include:

  • Solubilization: Extracting malG from membranes requires careful selection of detergents that maintain protein structure.

  • Stability: Membrane proteins often destabilize outside their native lipid environment.

  • Functionality: Ensuring the purified protein retains its transport capability.

These challenges can be addressed through:

  • Screening multiple detergents (DDM, LMNG, OG) for optimal solubilization

  • Including stabilizing agents like glycerol and specific lipids in purification buffers

  • Using mild purification conditions with limited exposure to high salt or extreme pH

  • Reconstituting the purified protein into liposomes or nanodiscs to assess functionality

The purification approach would involve membrane isolation, detergent solubilization, affinity chromatography using the fusion tag, and size exclusion chromatography for final polishing.

How can researchers verify the structural integrity and functionality of purified recombinant malG?

Verification of structural integrity and functionality should include multiple approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal stability assays using differential scanning fluorimetry

    • Limited proteolysis to assess proper folding

  • Functional assessment:

    • Reconstitution into proteoliposomes for transport assays

    • ATPase activity assays in conjunction with the ATP-binding component

    • Binding assays with labeled maltose or maltodextrins

Additionally, researchers should consider developing antibodies against malG, similar to the approach used for FlaB , to facilitate detection and immunoprecipitation experiments.

Does malG contribute to V. vulnificus virulence, and if so, through what mechanisms?

While the direct role of malG in V. vulnificus virulence has not been definitively established in the provided search results, research on other bacterial pathogens suggests that nutrient acquisition systems often contribute to virulence. The contribution of malG to virulence may involve:

  • Enhancing bacterial fitness in the host by facilitating efficient carbohydrate utilization

  • Potentially contributing to biofilm formation, which is important for bacterial persistence

  • Possible moonlighting functions beyond maltose transport

To investigate this question, researchers could develop malG deletion mutants and assess virulence properties using methods similar to those employed for studying other V. vulnificus virulence factors like MARTX toxin or flagellin proteins . Assessment could include in vitro cytotoxicity assays and in vivo infection models, quantifying bacterial burdens in tissues comparable to the approaches described in the FlaB immunization studies .

How does malG expression change during different stages of V. vulnificus infection?

Expression of malG likely varies throughout the infection process as the bacterium encounters different microenvironments. To study this expression pattern, researchers could:

  • Use transcriptional reporter fusions (similar to the luxAB reporters used for fur regulation studies ) to monitor malG expression under different conditions

  • Perform RT-PCR analysis of malG expression during infection, using methodologies similar to those employed for studying the Fur regulon

  • Analyze malG protein levels using western blotting at different infection stages

Expression would likely increase in carbohydrate-limited environments and potentially be co-regulated with other virulence factors. The regulation might involve complex signaling pathways similar to the cFP-mediated quorum sensing pathway described for katG regulation .

Can malG function be targeted to attenuate V. vulnificus virulence?

Targeting malG function could potentially attenuate V. vulnificus virulence by limiting its nutrient acquisition capabilities. Potential approaches include:

  • Development of small molecule inhibitors that specifically block malG transport function

  • Identification of peptides that interfere with assembly of the maltose transport complex

  • Immunological targeting of accessible epitopes of malG

Research approaches could build upon the immunization strategies described for FlaB , adapting them to target malG. If accessible epitopes of malG are present on the bacterial surface, antibodies could potentially interfere with maltose transport. Evaluation of such approaches would require methodologies similar to those used to assess bacterial burdens after FlaB immunization .

What factors regulate malG expression in V. vulnificus?

Though specific regulators of malG are not described in the search results, its expression is likely regulated by:

  • Carbon catabolite repression systems responding to glucose availability

  • Global stress response regulators like RpoS (mentioned in search result )

  • Potentially iron availability through Fur regulation, similar to other transport systems

To investigate these regulatory pathways, researchers could employ approaches similar to those used for studying fur regulation , including:

  • Construction of promoter-reporter fusions to measure expression under different conditions

  • Gel shift assays to identify protein-DNA interactions at the malG promoter

  • Chromatin immunoprecipitation to identify transcription factors binding to the malG promoter region in vivo

How do environmental conditions affect malG expression and function?

Environmental conditions likely influencing malG expression include:

  • Carbon source availability (particularly presence/absence of preferred carbon sources)

  • Osmolarity (relevant for adaptation to marine vs. host environments)

  • Temperature (important during transition from environment to human host)

  • Iron availability (which regulates many transport systems through Fur )

Methodological approaches to study these effects could include:

  • β-galactosidase activity assays with malG-lacZ fusions under varying conditions, similar to those described for fur-regulated genes

  • RT-PCR analysis of malG expression under different environmental conditions

  • Proteomic analysis to quantify malG protein levels across conditions

What is the relationship between malG expression and other virulence factors in V. vulnificus?

The expression of malG may be coordinated with other virulence factors as part of integrated virulence programs. To investigate this relationship, researchers could:

  • Perform transcriptomic analyses comparing expression patterns of malG with known virulence factors like MARTX toxins and flagellins under various conditions

  • Create malG mutants and assess impacts on virulence factor expression

  • Investigate potential regulators that co-regulate malG and virulence genes

The Fur-iron complex, which regulates multiple virulence factors including catalase activity , might also influence malG expression as part of a broader adaptive response. Methodologies similar to those used for studying Fur regulation of katG could be adapted for investigating malG regulation.

What structural features of malG are critical for its function in V. vulnificus?

Critical structural features of malG likely include:

  • Transmembrane domains that form the transport channel

  • Substrate-binding sites that specifically recognize maltose/maltodextrins

  • Interaction interfaces with other components of the transport complex

Methodological approaches to identify these features include:

  • Site-directed mutagenesis of conserved residues

  • Chimeric protein construction with related transporters

  • Structural studies using cryo-electron microscopy or X-ray crystallography (if crystals can be obtained)

  • Computational modeling based on homologous proteins with known structures

How does malG interact with other components of the maltose transport system?

MalG functions as part of a multi-protein complex, interacting with:

  • MalF (the other transmembrane component)

  • MalK (the ATP-binding component)

  • MalE (the periplasmic maltose-binding protein)

These interactions can be investigated using:

  • Co-immunoprecipitation experiments

  • Bacterial two-hybrid systems

  • Surface plasmon resonance to measure binding kinetics

  • Crosslinking studies followed by mass spectrometry

  • Pull-down assays with tagged components

Researchers could adapt methodologies similar to those used for studying protein interactions in V. vulnificus , incorporating techniques like western blotting with specific antibodies.

What advanced techniques are most valuable for studying the structure-function relationship of recombinant malG?

Advanced techniques for structure-function studies include:

  • Cryo-electron microscopy for structural determination without crystallization

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and binding interfaces

  • Single-molecule tracking to observe transport events in real-time

  • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) for maintaining native-like membrane environments

  • Molecular dynamics simulations to predict conformational changes during transport

A comprehensive approach would combine structural data with functional assays, potentially including transport measurements in reconstituted systems and binding assays with fluorescently labeled substrates.

How conserved is malG across different V. vulnificus strains and other Vibrio species?

Studying malG conservation requires comparative genomic approaches similar to those used for analyzing rtxA1 variants . Researchers should:

  • Perform sequence alignments of malG from multiple V. vulnificus strains

  • Compare with homologs from other Vibrio species

  • Conduct phylogenetic analyses to understand evolutionary relationships

The study of rtxA1 genetic variation across 40 V. vulnificus Biotype 1 strains provides a methodological template for studying malG conservation. Researchers should examine whether malG shows evidence of recombination events similar to those observed for rtxA1, which could indicate evolutionary adaptation to different environments.

Are there strain-specific differences in malG that correlate with virulence or ecological niche?

To address this question, researchers should:

  • Compare malG sequences from clinical and environmental isolates

  • Correlate sequence variations with virulence phenotypes and isolation sources

  • Test functional consequences of identified variations using recombinant proteins

The finding that V. vulnificus virulence factors undergo significant genetic rearrangement suggests that malG might also show functional diversity across strains. Researchers could adapt the MLST (Multilocus Sequence Typing) approach mentioned for rtxA1 to correlate malG variations with lineages known to differ in virulence potential.

Has horizontal gene transfer played a role in malG evolution in V. vulnificus?

Investigating horizontal gene transfer (HGT) involvement in malG evolution would include:

  • Analyzing GC content and codon usage of malG compared to the rest of the genome

  • Searching for mobile genetic elements surrounding malG

  • Conducting phylogenetic analyses to identify incongruences suggesting HGT

The observed recombination of rtxA1 with genes from plasmids or other marine pathogens suggests that similar mechanisms might have influenced malG evolution. Researchers should examine whether malG shows evidence of acquisition from other species or plasmids, potentially contributing to adaptive advantages in specific environments.

Can recombinant malG be used as a diagnostic marker for virulent V. vulnificus strains?

To evaluate malG's potential as a diagnostic marker, researchers should:

  • Determine whether specific malG variants correlate with clinical isolates

  • Develop antibodies or nucleic acid probes specific to these variants

  • Validate diagnostic assays using diverse strain collections

The approach would be similar to the sequencing strategy used for rtxA1 variants , but focused on identifying diagnostic signatures in malG. If specific malG variants are enriched in clinical isolates, they could serve as markers for strains with higher virulence potential.

What is the potential of malG as a vaccine target against V. vulnificus infections?

Evaluating malG as a vaccine target would involve:

  • Identifying immunogenic epitopes, focusing on regions accessible at the bacterial surface

  • Developing recombinant subunit vaccines containing these epitopes

  • Testing immunogenicity and protective efficacy in animal models

Researchers could adapt the methodology used for FlaB immunization studies , which demonstrated reduced bacterial burdens at infection sites. The approach would include immunization protocols, challenge with live bacteria, and assessment of bacterial loads in tissues and survival rates.

How might targeting malG complement existing therapeutic approaches for V. vulnificus infections?

Targeting malG could complement existing therapies by:

  • Limiting bacterial nutrient acquisition during infection

  • Potentially increasing susceptibility to antibiotics

  • Reducing bacterial fitness in host environments

This approach could be particularly valuable given concerns about on-going genetic variation in V. vulnificus virulence factors , which might lead to the emergence of strains with altered virulence. Combination therapies targeting both classical virulence factors and metabolic functions like malG could provide more comprehensive protection against diverse V. vulnificus strains.

What are the main technical challenges in studying recombinant malG, and how can they be addressed?

Major technical challenges include:

  • Membrane protein expression and stability issues

  • Difficulty in obtaining structural data due to the dynamic nature of transporters

  • Complexity of reconstituting functional transport systems in vitro

These challenges can be addressed through:

  • Optimized expression systems specifically designed for membrane proteins

  • Advanced structural biology techniques like cryo-EM that don't require crystallization

  • Development of functional assays in membrane mimetics like nanodiscs or liposomes

  • Computational approaches to predict structure and dynamics

What emerging technologies show promise for advancing research on V. vulnificus malG?

Promising emerging technologies include:

  • Cryo-electron tomography for visualizing transport complexes in their native membrane context

  • Single-molecule techniques to observe transport kinetics in real-time

  • CRISPR-Cas9 genome editing for precise manipulation of malG in V. vulnificus

  • Advanced computational methods for predicting protein-protein interactions and substrate binding

  • Microfluidic systems for high-throughput screening of transport inhibitors

These technologies could overcome current limitations in studying membrane protein function and provide unprecedented insights into malG structure and dynamics.

How might climate change affect the relevance of research on V. vulnificus malG?

Climate change implications for V. vulnificus research include:

  • Expanding geographical range of V. vulnificus as ocean temperatures rise

  • Increased incidence of infections, particularly wound infections

  • Potential evolutionary adaptations to new environments

The search results indicate that V. vulnificus virulence factors are undergoing significant genetic rearrangement , suggesting that climate change could drive further evolution. Research on fundamental aspects of V. vulnificus biology, including malG function, will become increasingly important for developing interventions against this expanding pathogen. Future studies should monitor how malG variants emerge and spread in response to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.