Recombinant Vibrio vulnificus Na (+)-translocating NADH-quinone reductase subunit C (nqrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
nqrC; VV2588; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
nqrC
Target Protein Sequence
MASNDSIKKTLGVVVGLSLVCSIIVSTAAVGLRDQQKANAVLDKQSKIIEVAGIDSKGKK VPELFAQYIEPRLVDFATGDFVDGNAATYDQRKAAKDPAQSIKLTAEQDDAKILRRANTG VVYLVKNGDSISKIILPVHGNGLWSMMYAFVAVETDGNTVSGITYYEQGETPGLGGEVEN PSWRAQFVGKKLFDENHKPAIKVVKGGAPVGSEHGVDGLSGATLTSNGVQHTFDFWLGDM GFGPFLAKVRDGGLN
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: vvy:VV2588

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does recombinant nqrC differ from native nqrC in Vibrio vulnificus?

The recombinant version of nqrC is engineered with specific modifications to facilitate laboratory research. The primary difference is the addition of an N-terminal His-tag, which enables simplified purification using affinity chromatography. The recombinant protein is expressed in E. coli expression systems rather than its native Vibrio vulnificus environment, which can potentially influence post-translational modifications.

When working with the recombinant form, researchers should consider that while the core structure and function are preserved, the His-tag and expression system may introduce subtle conformational changes that could affect certain protein interactions or enzymatic properties. Validation experiments comparing recombinant to native forms are recommended when studying specific biochemical characteristics .

What are the optimal storage and handling conditions for recombinant nqrC protein?

For optimal stability and activity retention of recombinant nqrC protein, researchers should follow these methodological guidelines:

  • Storage temperature: Maintain at -20°C/-80°C for long-term storage

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 30-50% for aliquots intended for long-term storage

  • Avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • Working aliquots can be stored at 4°C for up to one week

These conditions are specifically optimized for the His-tagged recombinant form of the protein and may differ from those required for native nqrC .

What experimental designs are most appropriate for studying nqrC function in antimicrobial resistance research?

When investigating nqrC's potential role in antimicrobial resistance mechanisms, the most effective experimental designs incorporate both reversal designs and multiple baseline measurements. For example:

  • Single-case experimental design with A-B-A reversal phases where:

    • Phase A1: Baseline measurements of antimicrobial susceptibility

    • Phase B: Introduction of recombinant nqrC or nqrC expression modifications

    • Phase A2: Return to baseline conditions

    • Phase B2: Reintroduction of nqrC intervention

This design allows for robust within-subject control and demonstrates causality through replication of effects. The minimum recommended design includes three phase replications (A1-B1-A2-B2), though four or more replications significantly strengthen internal validity.

Additionally, multiple baseline measurements across different antimicrobials or bacterial strains enhance external validity. When designing such experiments, randomization of intervention timing should be incorporated where possible to control for potential confounding variables .

For nqrC specifically, researchers should consider how the protein's sodium pump function might interact with membrane permeability factors that influence antibiotic resistance in Vibrio vulnificus .

How can researchers distinguish between the effects of nqrC and other Na(+)-translocating proteins in functional assays?

To methodologically distinguish nqrC effects from other Na(+)-translocating proteins, implement the following experimental approach:

  • Selective inhibition studies:

    • Utilize specific inhibitors of nqrC (such as HQNO or korormicin) at concentrations that selectively target nqrC without affecting other Na(+)-translocating proteins

    • Compare with broad-spectrum Na(+) transport inhibitors like amiloride

  • Genetic manipulation approach:

    • Create selective knockout models of nqrC while maintaining expression of other Na(+)-translocating proteins

    • Develop an isogenic strain series with varying levels of nqrC expression

  • Biochemical differentiation:

    • Exploit the unique redox properties of the nqrC subunit by monitoring specific electron transfer rates

    • Measure sodium transport rates in purified proteoliposomes containing only nqrC compared to proteoliposomes with other Na(+)-translocating proteins

  • Antibody-based methods:

    • Utilize highly specific antibodies against nqrC epitopes for immunoinhibition studies

    • Perform immunoprecipitation to isolate nqrC-specific complexes prior to functional assays

When analyzing results, apply rigorous statistical approaches including percentage of non-overlapping data (PND) analysis when comparing intervention effects across multiple conditions .

What methods are available for quantifying nqrC expression in Vibrio vulnificus clinical isolates?

Several methodological approaches can be employed to quantify nqrC expression in clinical Vibrio vulnificus isolates, each with specific advantages:

  • Quantitative PCR (qPCR):

    • Design primers specific to nqrC gene sequence (GenBank ID associated with Q7MIC9)

    • Normalize expression against established housekeeping genes for Vibrio species

    • Recommended for high throughput screening of multiple isolates

  • Western blot analysis:

    • Use anti-nqrC antibodies (commercial or custom-developed)

    • Quantify band intensity using densitometry

    • Compare against purified recombinant nqrC standards for absolute quantification

  • Mass spectrometry-based proteomics:

    • Implement selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

    • Target specific peptides unique to nqrC for quantification

    • Provides high specificity and sensitivity for complex samples

  • RNAseq approach:

    • Perform transcriptome analysis of clinical isolates

    • Map reads to the nqrC gene region

    • Calculate TPM (Transcripts Per Million) values for expression level

When analyzing clinical isolates, researchers should consider integrating these methods with antibiotic resistance profiling. Studies have shown that Vibrio vulnificus isolates exhibit varying resistance patterns (e.g., 80.95% resistance to vancomycin and 100% resistance to imipenem in one study), which may correlate with expression patterns of membrane proteins like nqrC .

How does nqrC contribute to the pathogenesis of Vibrio vulnificus, and what experimental frameworks best elucidate this relationship?

The contribution of nqrC to Vibrio vulnificus pathogenesis can be investigated through a multi-level experimental framework that addresses both direct and indirect mechanisms:

  • Energy metabolism and pathogen fitness:

    • Measure growth kinetics and competitive index of wild-type vs. nqrC-deficient strains in varying sodium concentrations that mimic different host environments

    • Quantify ATP production and proton motive force generation to correlate with virulence factor expression

    • Implement calorimetric assays to measure real-time energetics during infection models

  • Host-pathogen interaction models:

    • Develop cell culture infection models using human intestinal epithelial cells and macrophages

    • Quantify adhesion, invasion, and intracellular survival rates

    • Measure host cell responses including inflammatory cytokine production and cell death pathways

  • Virulence factor regulation:

    • Investigate whether sodium gradient disruption affects expression of known virulence factors such as capsular polysaccharide (CPS), hemolysin/cytolysin, and RTX toxins

    • Perform transcriptome analysis comparing wild-type and nqrC-mutant strains under infection-mimicking conditions

    • Use reporter gene constructs to monitor real-time virulence gene expression

  • In vivo infection models:

    • Implement single-case experimental designs with multiple baseline measurements across different mouse strains

    • Apply percentage of non-overlapping data (PND) analysis when comparing infection outcomes

    • Use tissue-specific sodium concentration manipulation to test nqrC dependency

These approaches should be integrated with genomic data showing that clinical Vibrio vulnificus isolates frequently possess multiple virulence factors including RTX genes, CPS genes, and hemolysins (vvh), which work in concert with energy-generating systems during infection .

What are the methodological challenges in resolving structural-functional relationships of nqrC in membrane complexes?

Resolving structural-functional relationships of nqrC within membrane complexes presents several methodological challenges that require specific technical approaches:

  • Membrane protein crystallization barriers:

    ChallengeMethodological Solution
    Detergent interferenceImplement lipidic cubic phase crystallization
    Protein instabilityUse fusion proteins or antibody fragment complexes to stabilize structure
    Conformational heterogeneityApply single-particle cryo-EM for capturing multiple states
    Low expression yieldsDevelop specialized expression systems with membrane-protein chaperones
  • Functional reconstitution complexities:

    • Develop proteoliposome systems that recapitulate the native lipid environment

    • Establish reliable methods for measuring Na+ transport coupled to electron transfer

    • Implement patch-clamp electrophysiology for single-complex measurements

  • Integrating structural and functional data:

    • Correlate amino acid substitutions (site-directed mutagenesis) with both structural changes and functional outcomes

    • Develop computational models that predict dynamic interactions during the catalytic cycle

    • Implement hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • In situ structural determination:

    • Apply correlative light and electron microscopy (CLEM) to locate and visualize nqrC complexes in native membranes

    • Implement electron tomography for 3D visualization of membrane complexes

    • Develop proximity labeling methods to map interaction partners in live bacterial cells

When designing structural biology experiments with nqrC, researchers should consider using the recombinant His-tagged protein (255 amino acids) described in the product information, which can facilitate purification while potentially introducing structural constraints that must be accounted for in analysis .

How can conflicting data on nqrC's role in antibiotic resistance be reconciled through advanced experimental designs?

Reconciling conflicting data regarding nqrC's role in antibiotic resistance requires sophisticated experimental designs that address multiple sources of variation:

  • Implement mixed-methods research design:

    • Quantitative component: Measure MICs across multiple antibiotics with controlled nqrC expression

    • Qualitative component: Perform in-depth phenotypic characterization of resistant strains

    • Integration phase: Cross-validate findings using triangulation methods

  • Address strain-specific genetic backgrounds:

    • Create isogenic strain panels where only nqrC differs

    • Analyze whole-genome sequencing data to identify potential genetic modifiers

    • Implement transposon sequencing to identify genetic interactions with nqrC

  • Reconcile phenotype-genotype discrepancies:

    • Consider post-transcriptional regulation of nqrC

    • Measure actual Na+ transport activity rather than merely gene presence

    • Evaluate environmental conditions that may trigger conditional resistance

  • Control for methodological variations:

    • Standardize antibiotic susceptibility testing methods

    • Implement blinded assessment of resistance phenotypes

    • Use multiple analytical approaches (e.g., PND analysis, effect size calculations)

  • Meta-analytical approach:

    • Systematically evaluate published data using forest plots

    • Calculate pooled effect sizes for nqrC's impact on specific antibiotics

    • Identify moderator variables that explain between-study heterogeneity

This approach addresses the discrepancies noted in research where gene presence does not always correlate with phenotypic resistance. For example, studies have shown that despite the presence of certain ARGs like adeF in all isolates, not all demonstrate increased resistance to the corresponding antibiotics, suggesting complex regulatory mechanisms or conditional expression .

What single-case experimental designs are most appropriate for testing nqrC inhibitors as potential antimicrobial agents?

For rigorous evaluation of nqrC inhibitors as potential antimicrobial agents, the following single-case experimental designs offer methodological advantages:

  • Multiple baseline design across:

    • Different bacterial strains with varying nqrC expression levels

    • Multiple drug concentrations to establish dose-response relationships

    • Different environmental conditions (pH, salt concentration, growth phase)

  • Alternating treatment design:

    • Systematically alternate between nqrC inhibitor alone, conventional antibiotics alone, and combination therapy

    • Include appropriate control phases to establish baseline susceptibility

    • Implement randomization of treatment sequence to control for order effects

  • Changing criterion design:

    • Gradually increase inhibitor concentration across phases

    • Establish stability at each concentration before proceeding

    • Determine minimum effective concentration with precision

  • ABAB reversal design with embedded probe conditions:

    • A phases: No nqrC inhibitor

    • B phases: nqrC inhibitor treatment

    • Embedded probes: Brief exposures to conventional antibiotics to test for sensitization

For data analysis, implement visual analysis techniques supplemented with quantitative metrics such as percentage of non-overlapping data (PND). According to methodological guidelines, a PND < 50 would indicate no observed effect, PND = 50–70 suggests a questionable effect, and PND > 70 indicates that the intervention was effective .

The minimum design should include three phase replications, though four or more significantly strengthen validity. When analyzing results, researchers should apply the percentage of non-overlapping corrected (PNDC) technique to account for pre-existing baseline trends .

How should researchers design experiments to investigate the relationship between nqrC expression and environmental factors in Vibrio vulnificus?

To methodically investigate relationships between nqrC expression and environmental factors in Vibrio vulnificus, researchers should implement the following experimental design framework:

  • Factorial experimental design:

    Environmental FactorExperimental LevelsMeasurement Approach
    Temperature10°C, 20°C, 30°C, 37°C, 42°CqRT-PCR for nqrC expression
    Salinity0.5%, 1.5%, 3.0%, 5.0%Western blot protein quantification
    pH5.0, 6.0, 7.0, 8.0, 9.0Activity assays for Na+ transport
    Oxygen tensionAnaerobic, Microaerobic, AerobicTranscriptome analysis
    Carbon sourceGlucose, Glycerol, Lactate, AcetateProteome analysis
  • Time-series experimental approach:

    • Implement continuous monitoring systems rather than endpoint measurements

    • Collect data at multiple time points to capture adaptation responses

    • Apply time-series analysis techniques to identify expression patterns

  • Environmental shift experiments:

    • Subject bacteria to rapid shifts in environmental conditions

    • Measure acute responses in nqrC expression and activity

    • Determine adaptation timeframes and regulatory mechanisms

  • In situ expression studies:

    • Develop reporter constructs fusing nqrC promoter to fluorescent proteins

    • Measure expression in simulated environmental conditions

    • Correlate with ecological parameters relevant to Vibrio vulnificus habitats

When analyzing results, researchers should apply mixed statistical methods including ANOVA for factorial components and time-series analysis for temporal data. This approach addresses the growing concern that climate warming may expand the geographical range of Vibrio vulnificus and increase infection risk in coastal regions, potentially altering the expression patterns of critical proteins like nqrC .

What are the methodological considerations for integrating nqrC studies with broader investigations of Vibrio vulnificus virulence?

Integrating nqrC studies with broader virulence investigations requires careful methodological planning:

  • Multi-level sampling strategy:

    • Collect environmental, clinical, and laboratory strain isolates

    • Implement systematic storage protocols (LB broth with 60% glycerol at -80°C)

    • Maintain comprehensive metadata on strain origins and phenotypic characteristics

  • Standardized virulence phenotyping:

    • Measure serum resistance and hemolytic ability across all isolates

    • Quantify biofilm formation capacity under standardized conditions

    • Assess cytotoxicity against multiple human cell types

  • Comprehensive genetic profiling:

    • Screen for virulence factor genes including capsular polysaccharide (CPS) genes, hemolysin/cytolysin genes, RTX gene clusters, and metalloproteases

    • Sequence nqrC alongside these virulence genes to identify potential linkages or genetic correlations

    • Perform whole-genome sequencing to identify novel genetic associations

  • Integrated data analysis approach:

    • Implement hierarchical clustering to identify patterns in virulence profiles

    • Perform principal component analysis to reduce dimensionality of complex datasets

    • Develop predictive models connecting nqrC variants to virulence phenotypes

  • Translation to clinical relevance:

    • Correlate findings with patient outcomes when using clinical isolates

    • Develop rapid diagnostic approaches that incorporate nqrC status

    • Integrate with antibiotic resistance profiles to guide treatment strategies

This integrated approach mirrors successful studies where researchers identified that clinical Vibrio vulnificus isolates frequently possess multiple virulence factors including CPS genes such as cpsAB, kpsF, cysC, and wcbTPN alongside toxin genes like cylA, hlyD, hlyB, and vvh (hlyA) .

How does nqrC expression correlate with the antibiotic resistance profiles observed in clinical Vibrio vulnificus isolates?

The correlation between nqrC expression and antibiotic resistance in clinical Vibrio vulnificus isolates presents a complex relationship that requires methodical investigation:

  • Transcriptional correlation analysis:

    • Measure nqrC expression levels using qRT-PCR across clinical isolates

    • Determine minimum inhibitory concentrations (MICs) for multiple antibiotic classes

    • Calculate correlation coefficients between expression levels and MIC values

    • Apply multivariate regression to account for confounding variables

Recent studies of clinical Vibrio vulnificus isolates from Ningbo, China (2013-2020) have revealed varying patterns of antibiotic resistance, with 80.95% showing resistance to vancomycin and 100% demonstrating resistance to imipenem. While specific correlations with nqrC expression were not directly reported, the presence of resistance genes like varG, adeF, and CRP was documented in these isolates .

  • Protein function analysis:

    • Quantify actual Na+ transport activity in resistant vs. susceptible isolates

    • Determine whether nqrC variants correlate with specific resistance patterns

    • Measure membrane potential changes in response to antibiotic exposure

  • Genetic association studies:

    • Screen for nqrC variants across isolate collections

    • Identify single nucleotide polymorphisms that correlate with resistance

    • Perform genetic complementation to confirm causal relationships

  • Mechanistic investigations:

    • Evaluate whether nqrC-mediated ion transport affects antibiotic uptake

    • Determine if nqrC activity influences expression of dedicated resistance genes

    • Assess potential indirect effects through metabolic or stress response pathways

While direct evidence linking nqrC to specific antibiotic resistance mechanisms remains limited in the current literature, research has demonstrated that discrepancies can exist between the presence of resistance genes and corresponding phenotypes. For example, despite the presence of adeF in all isolates studied, they did not uniformly exhibit increased resistance to tetracycline, suggesting complex regulatory mechanisms .

What experimental approaches can be used to investigate nqrC's role in Vibrio vulnificus adaptation to changing environmental conditions?

To investigate nqrC's role in Vibrio vulnificus adaptation to changing environments, researchers should employ these methodological approaches:

  • Experimental evolution studies:

    • Subject Vibrio vulnificus populations to gradually changing environmental conditions (temperature, salinity, pH)

    • Maintain parallel evolution lines with wild-type and nqrC-modified strains

    • Sequence evolved populations to identify adaptive mutations

    • Perform competition assays between ancestral and evolved strains

  • Transcriptional response mapping:

    • Implement RNA-seq analysis following environmental shifts

    • Compare transcriptional landscapes between wild-type and nqrC mutants

    • Identify gene networks co-regulated with nqrC

    • Validate key findings using reporter constructs and qRT-PCR

  • Physiological adaptation measurements:

    • Monitor growth parameters across environmental gradients

    • Measure cellular energetics (ATP production, membrane potential)

    • Quantify stress response activation markers

    • Assess biofilm formation capacity under varying conditions

  • Ecological sampling and analysis:

    • Collect environmental isolates across geographical and seasonal gradients

    • Characterize nqrC sequence variation and expression levels

    • Correlate with environmental parameters and isolation sources

    • Apply ecological niche modeling to predict distribution under climate change scenarios

These approaches address the growing concern that climate warming is likely to expand the geographical range of Vibrio vulnificus and increase infection risk in coastal regions. Comprehensive surveillance and ecological studies are critical for understanding how proteins like nqrC might contribute to this expansion .

How can advanced single-case designs be applied to study the effects of nqrC inhibitors on Vibrio vulnificus virulence in infection models?

Advanced single-case experimental designs offer powerful methodological frameworks for studying nqrC inhibitors' effects on Vibrio vulnificus virulence:

  • Multiple baseline across subjects design:

    • Implement infection models using different animal subjects

    • Stagger introduction of nqrC inhibitor intervention across subjects

    • Continuously monitor virulence indicators (tissue damage, bacterial load, cytokine responses)

    • Apply visual analysis techniques complemented by percentage of non-overlapping data (PND) analysis

  • Changing criterion design for dose optimization:

    • Begin with low inhibitor concentrations and progressively increase

    • Establish stability at each concentration before proceeding

    • Determine minimum effective concentration with precision

    • Apply PNDC (percentage of non-overlapping data corrected) to account for baseline trends

  • ABAB reversal design with embedded probes:

    • A phases: Infection without nqrC inhibitor

    • B phases: Infection with nqrC inhibitor

    • Embedded probes: Brief exposures to conventional treatments

    • Implement randomization of phase transitions where ethically feasible

  • Concurrent multiple probe design:

    • Simultaneously measure multiple virulence indicators

    • Apply intervention to one indicator domain while monitoring others

    • Systematically introduce intervention across all domains

    • Analyze cross-domain effects to understand mechanisms

For data analysis, apply visual analysis techniques supplemented with quantitative metrics. According to methodological standards, a minimum of three phase replications is required, though four or more significantly strengthen validity. Randomization should be incorporated where possible to improve internal validity and causal inference .

This approach aligns with best practices in single-case experimental design where replication across study phases or participants strengthens evidence for causal relationships between interventions (nqrC inhibitors) and outcomes (virulence reduction) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.