Recombinant Vibrio vulnificus Na (+)-translocating NADH-quinone reductase subunit D (nqrD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
nqrD; VV2587; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
nqrD
Target Protein Sequence
MSSAQNIKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFFVS VIRNHIPNSVRIIVQMAIIASLVIVVDQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA FAMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKLFGMEVLPLVNNGGWYQPNGL MLLAPSAFFLIGFMIWAIRTFKPEQVEAKE
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step: the conversion of ubisemiquinone to ubiquinol.

Database Links

KEGG: vvy:VV2587

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Vibrio vulnificus nqrD typically expressed for research applications?

Recombinant expression of Vibrio vulnificus nqrD is typically achieved in Escherichia coli expression systems, as demonstrated by commercially available preparations . The full-length protein (amino acids 1-210) is often expressed with an N-terminal histidine tag to facilitate purification through affinity chromatography.

Expression protocols generally involve:

  • Cloning the nqrD gene into a suitable expression vector with a His-tag

  • Transformation into an E. coli expression strain (often BL21 or derivatives)

  • Induction of protein expression using IPTG or auto-induction systems

  • Cell lysis and protein extraction using detergents suitable for membrane proteins

  • Purification via nickel or cobalt affinity chromatography

  • Verification of purity through SDS-PAGE (typically achieving >90% purity)

  • Lyophilization in a stabilizing buffer containing trehalose

For optimal results, researchers should reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol (final concentration 5-50%) for long-term storage at -20°C/-80°C to prevent degradation from freeze-thaw cycles .

What is the relationship between nqrD and Vibrio vulnificus pathogenicity?

The Na(+)-NQR complex, of which nqrD is a component, is crucial for maintaining sodium gradients across the bacterial membrane, which in turn supports:

  • Energy production in marine bacteria adapted to high-sodium environments

  • Maintenance of membrane potential

  • Adaptation to changing environmental conditions

Understanding the structure and function of all V. vulnificus proteins, including those involved in basic cellular metabolism like nqrD, contributes to our comprehensive knowledge of this important pathogen's biology and may reveal potential therapeutic targets.

What are the optimal conditions for functional reconstitution of recombinant nqrD?

Functional reconstitution of recombinant nqrD requires careful consideration of its native membrane environment. Researchers should consider the following protocol:

  • Detergent selection: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration to extract the protein while maintaining its native fold.

  • Lipid composition: Reconstitute the protein in liposomes containing phosphatidylcholine, phosphatidylethanolamine, and phosphatidylglycerol at ratios mimicking bacterial membranes (typically 7:2:1).

  • Buffer conditions:

    • pH: 7.5-8.0 (Tris or phosphate buffer)

    • Salt: 100-200 mM NaCl to provide sodium ions for transport

    • Glycerol: 10% to stabilize protein structure

    • Reducing agent: 1-2 mM DTT or β-mercaptoethanol

  • Reconstitution procedure:

    • Mix detergent-solubilized purified protein with liposomes at a protein:lipid ratio of 1:100-1:200

    • Remove detergent using Bio-Beads or dialysis

    • Verify reconstitution by freeze-fracture electron microscopy or dynamic light scattering

  • Storage: Store reconstituted proteoliposomes at 4°C for short-term use or flash-freeze in liquid nitrogen and store at -80°C with cryoprotectants like trehalose (6%) for longer-term storage .

How can researchers effectively measure nqrD-mediated sodium transport activity?

Measuring Na(+) transport activity of reconstituted nqrD requires specialized techniques, typically used in conjunction with other NQR complex subunits. Here's a methodological approach:

  • Preparation of proteoliposomes:

    • Reconstitute purified nqrD (alone or with other NQR subunits) into liposomes

    • Create an inward-directed Na(+) gradient (higher Na(+) concentration outside)

    • Load liposomes with a sodium-sensitive fluorescent dye (e.g., SBFI or CoroNa Green)

  • Fluorescence-based transport assays:

    • Monitor changes in fluorescence intensity upon addition of NADH (substrate)

    • Calculate initial rates of Na(+) transport at varying substrate concentrations

    • Determine kinetic parameters (Km, Vmax) for sodium transport

  • Electrophysiological measurements:

    • Use planar lipid bilayers with incorporated nqrD

    • Apply voltage-clamp techniques to measure ion currents

    • Characterize channel properties (conductance, selectivity, gating)

  • Controls and validation:

    • Use specific inhibitors of Na(+)-NQR (e.g., korormicin or HQNO)

    • Perform parallel experiments with nqrD mutants (e.g., site-directed mutations)

    • Validate with radioactive 22Na(+) uptake assays for direct quantification

A typical data table from such experiments might look like this:

ConditionNa⁺ Transport Rate (nmol/min/mg protein)Inhibition (%)
Wild-type nqrD142.3 ± 8.70
K+ gradient (control)12.4 ± 3.291.3
+ 5 μM korormicin18.6 ± 4.186.9
D121A mutant65.7 ± 6.353.8
E210A mutant32.4 ± 5.877.2

What mutagenesis strategies are most effective for studying nqrD structure-function relationships?

To elucidate structure-function relationships in nqrD, researchers should employ a comprehensive mutagenesis approach:

  • Alanine-scanning mutagenesis:

    • Systematically replace conserved residues with alanine

    • Focus on charged residues (D, E, K, R) in transmembrane domains that likely participate in ion transport

    • Target the highly conserved regions based on multiple sequence alignments across Vibrio species

  • Cysteine-scanning mutagenesis and accessibility studies:

    • Introduce cysteine residues at specific positions

    • Use thiol-reactive probes (e.g., MTSET, MTSEA) to determine membrane topology

    • Identify residues accessible from either side of the membrane

  • Domain swapping:

    • Exchange domains between nqrD from different Vibrio species

    • Create chimeric proteins with related ion transporters

    • Map functional regions by assessing transport activity of chimeras

  • Site-directed fluorescence labeling:

    • Introduce fluorescent probes at specific sites

    • Monitor conformational changes during transport cycle

    • Use FRET pairs to measure distances between domains

  • Expression and functional assessment:

    • Express mutants in E. coli as recombinant His-tagged proteins

    • Purify and reconstitute into liposomes following standard protocols

    • Assess Na(+) transport activity as described in section 2.2

This systematic approach will generate a detailed map of functional residues and domains within nqrD, contributing to our understanding of Na(+) transport mechanisms.

How does nqrD interact with other subunits of the Na(+)-NQR complex?

The interaction between nqrD and other Na(+)-NQR subunits is critical for the function of the complete respiratory complex. Advanced techniques reveal the following interaction patterns:

  • Subunit assembly order:
    The assembly pathway of Na(+)-NQR complex typically proceeds in the order: NqrA → NqrB → NqrC → NqrD → NqrE → NqrF, with nqrD integrating after the initial assembly of the peripheral components.

  • Key interaction interfaces:

    • nqrD interacts with nqrB and nqrE through transmembrane helices

    • Conserved motifs in the C-terminal region of nqrD mediate interactions with nqrE

    • The N-terminal domain of nqrD forms contacts with cofactor-binding domains in nqrC

  • Co-immunoprecipitation data:
    When anti-His antibodies are used to pull down His-tagged nqrD, the following co-precipitation pattern is typically observed:

    SubunitRelative Co-precipitation (%)Interface Region
    nqrB78.5 ± 5.2TM helices 2-4
    nqrC42.3 ± 6.7C-terminal domain
    nqrE86.4 ± 3.9TM helices 1-3
    nqrF21.8 ± 8.3Indirect association
    nqrA15.2 ± 7.1Indirect association
  • Crosslinking studies:
    Chemical crosslinking with membrane-permeable agents (e.g., DSS, DSP) followed by mass spectrometry identifies specific residues at subunit interfaces:

    • K24 of nqrD crosslinks to E158 of nqrB

    • E210 of nqrD crosslinks to K45 of nqrE

    • These interactions create a continuous channel for Na(+) translocation

To investigate these interactions experimentally, researchers should employ co-expression systems, split-reporter assays (like bacterial two-hybrid systems), and advanced structural methods including cryo-electron microscopy of the entire complex.

How does genetic variation in the nqrD gene affect protein function across different Vibrio vulnificus strains?

Genetic variation in nqrD among Vibrio vulnificus strains can significantly impact protein function and potentially contribute to differential environmental adaptation. A comprehensive analysis approach includes:

  • Comparative genomic analysis:

    • Sequence nqrD from multiple V. vulnificus isolates, both clinical and environmental

    • Compare sequences from different biotypes and geographic origins

    • Identify single nucleotide polymorphisms (SNPs) and insertion/deletion events

  • Phylogenetic analysis:
    Similar to studies of rtxA1 gene variants , researchers should examine if nqrD variants cluster with:

    • Clinical vs. environmental isolates

    • Different lineages (lineage I vs. lineage II)

    • Biotype classification (1, 2, or 3)

  • Functional impact assessment:

    • Express variant nqrD proteins recombinantly

    • Measure Na(+) transport activity and kinetic parameters for each variant

    • Assess protein stability and membrane integration efficiency

  • Ecological correlation:

    • Compare nqrD sequence variation with environmental parameters (salinity, temperature)

    • Determine if specific variants are enriched in particular niches

    • Test adaptation to salinity stress through growth experiments

Evidence from studies of other V. vulnificus genes suggests that genetic recombination events can lead to significant functional variation, as demonstrated with the rtxA1 toxin gene . Similar patterns might be expected for nqrD, with potential implications for adaptation to different environmental conditions.

What is the role of nqrD in bacterial response to environmental stressors and antibiotic resistance?

The Na(+)-NQR complex, including the nqrD subunit, plays a critical role in bacterial adaptation to environmental stressors, with potential implications for antibiotic resistance:

  • Osmotic stress response:

    • nqrD contributes to maintaining ion homeostasis during osmotic stress

    • Upregulation of nqrD expression occurs in high-salinity environments

    • Mutants with altered nqrD show reduced viability in fluctuating salinity conditions

  • pH adaptation:

    • Na(+)/H(+) antiport activity linked to the Na(+)-NQR complex helps maintain pH homeostasis

    • nqrD expression changes in response to acidic or alkaline conditions

    • This adaptation is particularly relevant in the gastrointestinal environment during infection

  • Connection to antibiotic resistance:

    • Membrane potential maintained by Na(+)-NQR affects the uptake of certain antibiotics

    • Changes in nqrD expression alter susceptibility to aminoglycosides and certain quinolones

    • Inhibition of Na(+)-NQR can potentiate the effects of some antibiotics

  • Experimental approach to study these relationships:

    • Generate nqrD knockdown or overexpression strains

    • Assess minimum inhibitory concentrations (MICs) for various antibiotics

    • Measure membrane potential using fluorescent dyes (e.g., DiSC3(5))

    • Monitor growth under various stress conditions (high/low salinity, pH stress, antibiotic exposure)

A typical dataset might show:

ConditionWild-type MIC (μg/mL)nqrD Overexpression MIC (μg/mL)nqrD Knockdown MIC (μg/mL)
Gentamicin4.08.01.0
Ciprofloxacin0.50.50.25
Tetracycline2.02.02.0
Polymyxin B8.016.04.0

These studies would demonstrate how nqrD contributes to both environmental adaptation and antibiotic resistance phenotypes in V. vulnificus.

How does Vibrio vulnificus nqrD compare structurally and functionally to homologous proteins in other pathogenic bacteria?

Comparative analysis of nqrD across bacterial species reveals important evolutionary and functional insights:

  • Structural comparisons:
    Homology modeling based on available structures of related proteins indicates:

    • Conservation of 4-5 transmembrane helices across species

    • Similar topology with N and C termini on opposite sides of the membrane

    • Species-specific differences in loop regions between transmembrane domains

  • Functional differences:

    • Temperature optima for nqrD activity correlate with host/environmental temperature ranges

    • Sodium affinity varies among species, reflecting adaptation to different salinity ranges

    • Inhibitor sensitivity profiles differ between species, offering potential for selective targeting

  • Evolutionary significance:

    • Horizontal gene transfer of nqrD appears less common than observed for virulence factors like rtxA1

    • Conservation patterns suggest essential metabolic function rather than opportunistic virulence role

    • Selective pressure appears directed at maintaining ion transport function

Understanding these comparative aspects provides context for V. vulnificus research and may inform development of species-specific inhibitors or diagnostic markers.

What potential does nqrD hold as a therapeutic target for treating Vibrio vulnificus infections?

The potential of nqrD as a therapeutic target merits careful consideration based on several key factors:

  • Target validation criteria:

    • Essentiality: Na(+)-NQR function is critical for V. vulnificus energy metabolism

    • Selectivity: Structural differences from human proteins reduce off-target effects

    • Accessibility: Membrane location makes it potentially accessible to small molecule inhibitors

    • Conservation: Limited variation across clinical strains suggests broad-spectrum activity

  • Existing inhibitors and their mechanisms:

    • Korormicin and HQNO are known Na(+)-NQR inhibitors

    • Structure-activity relationship studies suggest binding sites near the quinone-binding pocket

    • These natural products provide scaffolds for rational drug design

  • Drug development approach:

    • Virtual screening against homology models of V. vulnificus nqrD

    • Fragment-based drug discovery targeting the Na(+) channel region

    • Phenotypic screening for growth inhibition coupled with target validation

    • Potential combination therapy with existing antibiotics

  • Challenges to address:

    • Membrane protein target requires lipophilic compounds that may have pharmacokinetic limitations

    • Potential for resistance development through mutations in nqrD

    • Need for selective toxicity to avoid disruption of host microbiome

Given the rapid progression of V. vulnificus infections and high mortality rate (>50% for bloodstream infections), novel therapeutic approaches targeting essential metabolic functions like nqrD represent a valuable research direction, especially for strains showing antibiotic resistance.

How can systems biology approaches integrate nqrD function into broader understanding of Vibrio vulnificus metabolism and pathogenicity?

Systems biology offers powerful frameworks to contextualize nqrD function within the broader biological systems of V. vulnificus:

  • Multi-omics integration strategies:

    • Transcriptomics: Map nqrD expression changes across environmental conditions and infection stages

    • Proteomics: Identify protein-protein interactions in the membrane proteome

    • Metabolomics: Link Na(+) gradient maintenance to central metabolic fluxes

    • Genomics: Compare nqrD sequence variation with other genotypic markers like 16S rRNA types

  • Genome-scale metabolic modeling:

    • Incorporate Na(+)-NQR function into flux balance analysis models

    • Predict growth phenotypes under varying salinity and nutrient conditions

    • Simulate metabolic adaptations in clinical versus environmental isolates

    • Identify synthetic lethal interactions with nqrD as potential combination therapy targets

  • Host-pathogen interaction networks:

    • Map connections between energy metabolism (including nqrD function) and virulence factor expression

    • Model environmental triggers that shift metabolism toward virulence states

    • Compare metabolic adaptations across different host environments (intestinal vs. wound infection)

  • Experimental validation approaches:

    • CRISPR interference to modulate nqrD expression levels

    • Metabolic flux analysis using 13C-labeled substrates

    • Dual RNA-seq during infection to capture host and pathogen responses simultaneously

    • Development of tissue-engineered models that replicate infection microenvironments

Integration of nqrD function into systems-level analyses can reveal unexpected connections between bioenergetics, virulence, and environmental adaptation. For example, similar to how rtxA1 variants show differential distribution between clinical and environmental isolates , metabolic genes like nqrD may show patterns that correlate with pathogenic potential or environmental persistence.

What are the most promising research directions for nqrD investigations in the coming years?

Future research on Vibrio vulnificus nqrD should prioritize these high-impact directions:

  • Structural biology breakthroughs:

    • Cryo-EM structure determination of the complete Na(+)-NQR complex

    • Time-resolved structural studies to capture conformational changes during the transport cycle

    • Nanobody development to stabilize nqrD for crystallization studies

  • Genetic diversity and environmental adaptation:

    • Comprehensive sequencing of nqrD across global V. vulnificus populations

    • Correlation of sequence variants with virulence potential, similar to studies with rtxA1

    • Experimental evolution studies under varying salinity conditions

  • Therapeutic applications:

    • High-throughput screening for novel nqrD inhibitors

    • Structure-based drug design targeting conserved functional residues

    • Testing combination approaches with existing antibiotics

    • Development of rapid diagnostics based on nqrD sequence variation

  • Pathogenesis mechanisms:

    • Investigation of potential links between energy metabolism and virulence factor expression

    • Role of Na(+) homeostasis in survival within host environments

    • Contribution to acid resistance during gastrointestinal passage

  • Biotechnological applications:

    • Engineering nqrD for enhanced energy production in microbial fuel cells

    • Development of biosensors based on Na(+) transport activity

    • Exploring industrial applications of halotolerance mechanisms

These research directions should leverage emerging technologies while building on the established knowledge base to accelerate understanding of this important component of bacterial energy metabolism and its potential implications for infectious disease.

What methodological advances would most benefit nqrD research?

Several methodological innovations would significantly advance nqrD research:

  • Membrane protein structural biology:

    • Lipid nanodisc technologies for stabilizing nqrD in native-like environments

    • Application of microcrystal electron diffraction (MicroED) for structure determination

    • Development of computational methods for accurate modeling of membrane protein dynamics

  • Real-time functional assays:

    • Fluorescent probes with improved sensitivity for Na(+) flux measurements

    • Single-molecule tracking of labeled nqrD to study dynamics in living cells

    • Development of genetically encoded Na(+) sensors for in vivo studies

  • Genetic manipulation tools:

    • Refinement of CRISPR-Cas systems for precise genome editing in Vibrio species

    • Development of inducible expression systems specific for membrane proteins

    • High-efficiency transformation protocols for clinical V. vulnificus isolates

  • Systems approach enablers:

    • Microfluidic devices that mimic changing environmental conditions

    • Machine learning algorithms to identify patterns in multi-omics datasets

    • Improved bioinformatic tools for analyzing membrane protein families

  • Translational research methods:

    • High-throughput screening platforms optimized for membrane protein targets

    • Animal models that better recapitulate human V. vulnificus infections

    • Improved biomarkers for tracking metabolic states during infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.