Recombinant Vibrio vulnificus Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
nqrE; VV2586; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
nqrE
Target Protein Sequence
MEHYISLLIKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY NLVLKENALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGAGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: vvy:VV2586

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Na(+)-translocating NADH:quinone oxidoreductase in Vibrio species?

Na(+)-translocating NADH:quinone oxidoreductase (Na(+)-NQR) is a membrane-associated enzyme complex comprising six subunits that functions as a primary sodium pump in Vibrio species. This enzyme catalyzes the oxidation of NADH and the reduction of quinone coupled with sodium ion translocation across the bacterial membrane. In Vibrio cholerae, the enzyme exhibits high specific activity in the presence of sodium, with NADH consumption occurring at a turnover rate of approximately 720 electrons per second . The complex contains multiple redox centers, including three flavins and a 2Fe-2S center, which facilitate electron transfer during catalysis . The nqrE subunit plays a crucial role within this complex, contributing to the membrane association and ion translocation machinery.

How does genetic recombination affect the expression and function of membrane proteins like nqrE in Vibrio vulnificus?

Genetic recombination plays a significant role in generating diversity in Vibrio vulnificus virulence factors. While specific recombination events affecting nqrE aren't detailed in the search results, the mechanism can be inferred from studies of other Vibrio genes. For example, the rtxA1 gene in V. vulnificus undergoes recombination with related genes from plasmids or other Vibrio species, generating toxin variants with different arrangements of effector domains . Such recombination events can significantly alter protein function and virulence potential. Similar recombination mechanisms could affect the nqr operon, potentially creating variants of the Na(+)-NQR complex with altered sodium translocation efficiency or substrate specificity.

What techniques are most effective for identifying genetic variants of the nqr operon in clinical versus environmental isolates of Vibrio vulnificus?

Based on methodologies used for similar studies, effective techniques for identifying nqr operon variants include:

  • PCR amplification using primers targeting conserved regions of the nqr operon

  • Sequencing of the full operon (all six subunits including nqrE)

  • Bioinformatic analysis to identify recombination sites and potential donor sequences

  • Molecular typing using specific genetic markers for different variants

A comparative approach examining isolates from different sources is crucial. For instance, studying clinical isolates alongside environmental strains enables identification of genetic variations potentially associated with enhanced virulence . Such analysis should include targeted PCR of the nqr genes followed by sequence analysis to identify potential recombination sites, similar to the approach used for rtxA1 gene variants in V. vulnificus .

What are the optimal conditions for expressing and purifying recombinant nqrE from Vibrio vulnificus?

Based on successful approaches with related proteins, optimal expression and purification of recombinant nqrE would likely follow these methodological steps:

  • Cloning the nqrE gene under a regulatable promoter (such as the P(BAD) promoter used for the V. cholerae nqr operon)

  • Expression in a host strain where the genomic copy of the targeted gene has been deleted to avoid interference from native protein

  • Addition of a purification tag (such as a six-histidine tag) to facilitate affinity chromatography

  • Careful selection of detergent for membrane protein solubilization (dodecyl maltoside has been effective for Na(+)-NQR from V. cholerae)

  • Purification using affinity chromatography under conditions that maintain protein activity

The choice of expression host is critical, with expression in Vibrio species often yielding better results than heterologous expression in E. coli for membrane proteins due to compatibility of membrane composition and protein processing machinery .

How can researchers effectively measure the functional activity of recombinant nqrE in isolation versus within the complete Na(+)-NQR complex?

Functional characterization of nqrE presents unique challenges since it normally functions as part of a multi-subunit complex. A methodological approach should include:

For complete complex activity measurement, researchers can monitor:

  • NADH oxidation spectrophotometrically

  • Quinone reduction

  • Sodium gradient formation using sodium-sensitive fluorescent dyes

  • Membrane potential generation using voltage-sensitive dyes

These measurements should be conducted in reconstituted systems where the protein concentration and orientation can be controlled .

How does the nqrE subunit contribute to antibiotic resistance mechanisms in Vibrio vulnificus?

While direct evidence linking nqrE to antibiotic resistance is not provided in the search results, broader research on membrane-associated energy transduction systems suggests potential mechanisms:

  • Contribution to proton motive force or sodium motive force that drives efflux pumps

  • Involvement in maintaining membrane integrity during antibiotic stress

  • Possible interaction with dedicated antibiotic resistance proteins

Research on V. vulnificus antibiotic resistance shows that these bacteria harbor various antibiotic resistance genes (ARGs) such as PBP3, parE, adeF, varG, and CRP, conferring resistance to beta-lactams, fluoroquinolones, and carbapenems . The energy provided by Na(+)-NQR may be crucial for the function of efflux pumps encoded by some of these genes. Future research should investigate whether inhibition of Na(+)-NQR components, including nqrE, affects the antibiotic susceptibility profile of V. vulnificus.

What is the relationship between Na(+)-NQR activity and virulence factor expression in Vibrio vulnificus?

The relationship between energy metabolism and virulence factor expression is complex and likely bidirectional. Energy-generating systems like Na(+)-NQR provide the ATP and ion gradients necessary for the expression and function of virulence factors. Clinical isolates of V. vulnificus express numerous virulence factors including hemolysins (cylA, hlyD, hlyB, hlyA/vvh), MARTX gene clusters (rtxABCD), metalloproteases, and various capsular polysaccharide genes .

The expression of these virulence factors requires significant energy input, suggesting that efficient Na(+)-NQR function may be a prerequisite for full virulence. Conversely, environmental conditions that affect Na(+)-NQR function may serve as signals for regulating virulence gene expression, creating a feedback loop between energy metabolism and virulence. Research examining transcriptomic changes under conditions that inhibit Na(+)-NQR function would help elucidate this relationship.

How should researchers address contradictory findings between biochemical and genetic studies of nqrE function?

When facing contradictory findings between different experimental approaches, researchers should:

  • Carefully examine methodological differences that might explain the discrepancies

  • Consider whether the contradictions reflect genuine biological complexity rather than experimental artifacts

  • Develop integrative models that account for seemingly contradictory observations

  • Design critical experiments specifically targeting the apparent contradictions

As noted in research methodology literature, quantitative and qualitative approaches often complement each other and may reveal different aspects of the same biological system . For example, biochemical studies might show nqrE is essential for Na(+)-NQR function in vitro, while genetic studies might find viable mutants lacking nqrE under specific conditions. Such contradictions might reveal context-dependent functions or compensatory mechanisms that are biologically meaningful rather than experimental errors.

What approaches can resolve discrepancies between in vitro enzymatic studies and in vivo pathogenicity observations for Na(+)-NQR mutants?

To resolve discrepancies between in vitro and in vivo studies, researchers should:

  • Examine whether laboratory conditions adequately reflect the host environment, particularly regarding ion concentrations, pH, and available carbon sources

  • Consider temporal aspects of infection, as different virulence factors may be important at different stages

  • Develop more sophisticated infection models that better recapitulate human infection

  • Implement complementation studies to confirm phenotype specificity

  • Employ techniques like RNA-seq to identify compensatory mechanisms activated in vivo but not in vitro

The apparent contradiction between in vitro enzyme function and in vivo pathogenicity might reflect the complexity of host-pathogen interactions. For instance, research on V. vulnificus rtxA1 gene variants shows that clinical isolates often carry toxin variants with reduced potency compared to environmental isolates, suggesting selection for altered virulence in different environments . Similar complexity might apply to Na(+)-NQR function, necessitating careful experimental design that bridges in vitro biochemistry and in vivo pathogenesis.

What statistical approaches are most appropriate for analyzing the correlation between nqrE sequence variants and clinical outcomes?

For analyzing correlations between nqrE sequence variants and clinical outcomes, the following statistical approaches are recommended:

  • Phylogenetic analyses to establish evolutionary relationships between variants

  • Multinomial logistic regression to assess associations between specific variants and disease manifestations

  • Survival analysis (Kaplan-Meier curves, Cox proportional hazards models) to evaluate relationships between variants and mortality

  • Principal component analysis to identify patterns across multiple virulence factors

When designing such studies, researchers should carefully consider:

  • Sample size requirements for adequate statistical power

  • Need for correction for multiple comparisons

  • Potential confounding factors such as patient demographics and comorbidities

  • Integration of multiple data types (genomic, clinical, ecological)

These approaches should be adaptable to account for the dynamic nature of bacterial populations and the potential emergence of new variants through recombination events .

How can researchers develop standardized assays to compare Na(+)-NQR activity across different Vibrio species and strains?

Developing standardized assays for cross-species comparison requires:

  • Identification of conserved biochemical properties across different species

  • Establishment of standardized expression and purification protocols

  • Development of activity assays that account for species-specific differences in optimal conditions

ParameterStandardized Measurement ApproachConsiderations for Cross-Species Comparison
NADH oxidation rateSpectrophotometric assay monitoring absorbance at 340 nmAccount for different temperature and pH optima
Na+ dependencyMeasure activity across Na+ concentration gradientDifferent species may have different Na+ affinities
Quinone reductionMonitor decrease in ubiquinone concentration by HPLCConsider species-specific quinone preferences
Membrane potential generationFluorescence-based assays using voltage-sensitive dyesStandardize lipid composition in reconstituted systems
Enzyme stabilityThermal shift assaysMay vary significantly between mesophilic and thermophilic species

This standardized approach would facilitate meaningful comparisons between Na(+)-NQR activity in V. vulnificus and other Vibrio species, potentially revealing evolutionary adaptations related to different ecological niches and pathogenic potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.