Recombinant Vibrio vulnificus Probable intracellular septation protein A (VV1213)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare accordingly.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, please inform us in advance as additional fees may apply.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; VV1213; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
VV1213
Target Protein Sequence
MKQILDFIPLIIFFALYKMYDIYVATGALIAATAIQIVVTYALYKKVEKMQLITFLMVAI
FGGMTIFLHDDNFIKWKVTIVYAVFAIGLTVSHVMGKSAIKGMLGKEITLPESVWANINW
AWVGFFTFCAGLNIYVAYQLPLDVWVNFKVFGLLAATLVFTVLTGGYIYKHLPKEQNGQS
SDVPTDE
Uniprot No.
Target Background
Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
KEGG: vvy:VV1213
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
