Recombinant Vibrio vulnificus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is preferred, please notify us in advance as additional charges may apply.
Notes
Repeated freeze-thaw cycles should be avoided. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses and avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
lgt; VV0678; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
lgt
Target Protein Sequence
MSQGYLPFPNIDPVFFSIGPISVRWYGLMYLFGFLFAMWLANRRADKPGSGWTREQVSDL LFAGFLGVVLGGRIGYVLFYNFDLFLADPIYLFKVWTGGMSFHGGLLGVITAMLWYAKKN GRTFFGVADFVAPLVPFGLGVGRLGNFMNGELWGRVTDVPWAMVFPTGGPLPRHPSQLYE MALEGVLLFFILNWFIRKPRPLGSVSGLFLAGYGTFRFLVEYVREPDAQLGLFGGFISMG QILSSPMIIGGLALMAWAYKRGHYQDKVTVK
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This enzymatic reaction constitutes the initial step in the biosynthesis of mature lipoproteins.
Database Links

KEGG: vvy:VV0678

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Lgt in bacterial physiology and pathogenesis?

Lgt catalyzes the first step in bacterial lipoprotein biosynthesis by transferring a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox of prelipoproteins. This lipid modification is essential for proper anchoring of lipoproteins to bacterial membranes, affecting various cellular processes including cell envelope integrity and virulence in pathogenic bacteria like Vibrio vulnificus. The lipid-modified proteins play crucial roles in nutrient acquisition, cell signaling, and host-pathogen interactions.

In Vibrio vulnificus specifically, lipoproteins are significant virulence factors that contribute to the bacterium's ability to cause fatal septicemia. Similar to other locomotive bacteria, V. vulnificus can invade the bloodstream across intestinal mucosal barriers, with motility being important for penetrating mucosa and accessing underlying epithelial cells .

What are the key structural features of bacterial Lgt enzymes?

The X-ray crystal structure of Lgt reveals multiple transmembrane domains with two membrane-embedded arms (one preceding TM1 and the other between TM2 and TM3), and a central cavity containing two binding sites for the PG substrate . PG is proposed to move from the first site to the second site, where the diacylglyceryl moiety is transferred to the lipobox of the preprolipoprotein. The modified lipobox then exits from the side cleft of Lgt.

In the crystal structure, the second PG binding site (the active site) is typically occupied by a diacylglycerol (DAG) molecule, which is the hydrolyzed product of PG, rather than the intact PG substrate . This suggests that the crystallized structure may represent a post-catalytic state rather than the active conformation during catalysis.

How does the catalytic mechanism of Lgt function during lipid transfer?

Molecular studies indicate that His103 functions as a catalytic base in the diglyceride transfer reaction, abstracting a proton from the conserved cysteine residue of the preprolipoprotein . This deprotonation enables the nucleophilic attack of the cysteine thiolate on the C3 atom of PG, resulting in the transfer of the diacylglyceryl moiety to the preprolipoprotein and release of the glycerol-1-phosphate head group.

The reaction requires proper activation of the C3-O ester bond of PG for efficient catalysis . The protonation states of key residues are critical for catalytic activity, with His7 typically protonated while His24, His103, and His196 exist in the neutral form with the epsilon nitrogen protonated at physiological pH.

What expression systems are optimal for producing recombinant Vibrio vulnificus Lgt?

For recombinant expression of membrane proteins like V. vulnificus Lgt, E. coli-based expression systems are commonly employed due to their ease of manipulation and high yield potential. The following table outlines key considerations for expression system selection:

ParameterRecommended ApproachConsiderations
Host StrainC41(DE3), C43(DE3), or BL21(DE3) pLysSStrains engineered for membrane protein expression
Expression VectorpET or pBAD vectors with inducible promotersInclude affinity tags (His6, Strep) for purification
Induction Temperature16-20°CLower temperatures improve proper folding
Inducer ConcentrationIPTG (0.1-0.5 mM) or L-arabinose (0.002-0.2%)Optimize to prevent inclusion body formation
Detergent SelectionDDM, LDAO, or C12E8Critical for maintaining protein solubility and activity
Membrane FractionInner membrane preparationWhere Lgt naturally resides

The expression conditions should be optimized through small-scale tests before scaling up to ensure proper folding and integration into the membrane, which is critical for obtaining functionally active Lgt protein .

What are effective approaches for studying Lgt-substrate interactions?

Molecular docking and molecular dynamics (MD) simulations are powerful approaches for investigating Lgt-substrate interactions. Based on research methodologies, the following protocol is recommended:

  • Structure preparation: Start with available crystal structures (e.g., E. coli Lgt, PDB: 5AZC) as a template for modeling V. vulnificus Lgt.

  • Substrate preparation: For the preprolipoprotein substrate, use a partial sequence spanning the characteristic lipobox (e.g., GSTLLAGCSSN) for docking studies.

  • Docking methodology: Employ flexible peptide docking software like Flexpepdock to generate multiple models (at least 10) of the Lgt-lipobox complex .

  • Model evaluation: Assess docked poses based on the distance between the C3 atom of PG and the cysteine sulfur of the lipobox, and their orientation to predict catalytic feasibility.

  • MD simulation setup: Perform simulations at physiological temperature (310 K) using GPU-accelerated programs like PMEMD in Amber package .

  • Simulation systems: Generate multiple complexes: (I) Lgt with PG and DAG, (II) Lgt with two PG molecules, and (III) Lgt with PG molecules and the docked preprolipoprotein.

  • Lipid environment: Embed the protein-substrate complex in a lipid bilayer to mimic the natural membrane context .

These approaches provide critical insights into the structural basis of substrate recognition and the mechanism of lipid modification catalyzed by Lgt.

How can QM/MM calculations be used to elucidate the catalytic mechanism of Lgt?

Hybrid quantum mechanics/molecular mechanics (QM/MM) calculations are essential for understanding the electronic aspects of enzymatic reactions. For Lgt studies:

  • QM region selection: Include catalytically important residues (His103, the reactive cysteine of the lipobox) and the relevant portions of PG involved in bond breaking/formation.

  • MM region: Model the rest of the protein, membrane, and solvent using molecular mechanics force fields suitable for membrane proteins.

  • Reaction coordinate: Calculate the energy profile along the reaction coordinate, from substrate binding to product formation.

  • Transition state identification: Locate and characterize transition states to understand the energy barriers of the reaction.

  • Mechanistic analysis: Determine the role of His103 in proton abstraction and the subsequent nucleophilic attack by the cysteine thiolate on the C3 atom of PG .

QM/MM calculations have revealed that His103 functions as a catalytic base in the diglyceride transfer reaction, providing a detailed understanding of the catalytic mechanism at the electronic level .

How does Lgt from Vibrio vulnificus compare with homologs from other bacterial species?

While specific comparative data for V. vulnificus Lgt is limited in the available research, general principles of comparative analysis can be applied:

FeatureE. coli LgtPredicted V. vulnificus LgtSignificance
Catalytic HistidineHis103 functions as catalytic baseLikely conserved based on functional importanceCritical for enzyme activity
Membrane TopologyMultiple transmembrane domainsLikely similar topology with species-specific variationsAffects substrate accessibility
PG Binding SitesTwo distinct binding sitesProbably conserved with potential differences in binding affinityInfluences substrate specificity
Active Site CavityAccommodates lipobox peptideMay have variations affecting specificity for V. vulnificus prelipoproteinsPotential target for species-specific inhibitors

Understanding these comparative aspects is crucial for developing selective inhibitors targeting pathogenic bacteria while minimizing effects on commensal bacteria .

What mutagenesis strategies are most informative for studying Lgt function?

Strategic mutagenesis experiments can provide valuable insights into Lgt function:

  • Catalytic residue mutations: Substitution of His103 with alanine or asparagine would test its proposed role as a catalytic base.

  • Binding site modifications: Mutations in the PG binding sites can elucidate substrate recognition mechanisms.

  • Transmembrane domain alterations: Mutations in the membrane-embedded arms may affect protein stability and substrate channeling.

  • Lipobox recognition residues: Identifying and mutating residues involved in recognizing the characteristic lipobox sequence.

  • Conserved vs. variable residues: Comparative mutagenesis of residues conserved across species versus those unique to V. vulnificus.

Each mutant should be characterized for expression, stability, membrane integration, and catalytic activity to build a comprehensive understanding of structure-function relationships .

How can researchers address the challenges of membrane protein crystallization for Vibrio vulnificus Lgt?

Membrane protein crystallization presents significant challenges. For V. vulnificus Lgt:

  • Detergent screening: Systematic testing of various detergents (DDM, LDAO, C12E8) to identify conditions that maintain protein stability and homogeneity.

  • Lipidic cubic phase (LCP) crystallization: This technique often succeeds where traditional methods fail for membrane proteins.

  • Protein engineering: Creating fusion constructs with crystallization chaperones (e.g., T4 lysozyme) or removing flexible regions to promote crystal contacts.

  • Surface entropy reduction: Mutating clusters of high-entropy surface residues to alanine to promote crystal formation.

  • Nanobody or antibody fragment complexes: These can provide additional crystal contacts and stabilize specific conformations.

  • Automated high-throughput screening: Testing thousands of crystallization conditions with minimal protein consumption.

  • Cryo-EM alternative: If crystallization proves difficult, single-particle cryo-electron microscopy offers an alternative structural determination method.

These approaches address the inherent challenges in membrane protein crystallization and increase the likelihood of obtaining high-resolution structural data for V. vulnificus Lgt .

What are the best approaches for analyzing variability in recombinant Lgt activity?

Rigorous statistical analysis is essential for characterizing batch-to-batch variability in recombinant Lgt activity:

  • Analysis of Variance (ANOVA): Determine if significant differences exist between expression batches.

  • Multiple linear regression: Identify experimental factors contributing to variability (expression temperature, induction time, cell density).

  • Principal Component Analysis (PCA): Identify patterns in multivariate data across batches.

  • Control charts: Monitor process stability over time and identify special cause variations.

  • Nested design studies: Quantify within-batch and between-batch variability components.

  • Non-parametric alternatives: Consider Kruskal-Wallis tests for non-normally distributed data.

The following table summarizes recommended statistical approaches for different scenarios:

Analysis GoalRecommended Statistical MethodData Requirements
Batch ComparisonOne-way ANOVA with Tukey's post-hocNormal distribution, equal variances
Factor Influence AnalysisMultiple linear regressionLinear relationships, independent observations
Process MonitoringShewhart control charts (X-bar, R)Subgroups of measurements
Multivariate Pattern DetectionPrincipal Component AnalysisCorrelated variables
Non-normal Data AnalysisKruskal-Wallis testRank-based data, non-normal distribution

These statistical approaches ensure robust interpretation of experimental data and guide process optimization.

How can researchers distinguish between specific and non-specific binding in Lgt-substrate interaction studies?

Distinguishing specific from non-specific interactions requires multiple complementary approaches:

  • Control experiments: Use mutated versions of the lipobox sequence where the conserved cysteine is replaced to identify non-specific interactions.

  • Competitive binding assays: Test whether known substrates or inhibitors compete with novel ligands.

  • Titration experiments: Analyze binding kinetics to differentiate high-affinity specific binding from low-affinity non-specific interactions.

  • Structural studies: Employ hydrogen-deuterium exchange mass spectrometry to map protein-substrate interaction regions.

  • Site-directed mutagenesis: Mutate residues predicted to be involved in specific binding and assess effects on substrate recognition.

  • Molecular dynamics simulations: Analyze the stability of binding poses over time to distinguish stable specific interactions from transient non-specific ones .

These approaches collectively provide a comprehensive assessment of binding specificity, which is crucial for understanding substrate recognition mechanisms and designing effective inhibitors.

What considerations are important when adapting E. coli Lgt research protocols for Vibrio vulnificus Lgt studies?

When transferring methodologies from E. coli to V. vulnificus Lgt research:

  • Codon optimization: Adjust the codon usage for optimal expression in the selected host system.

  • Expression temperature: V. vulnificus is a mesophilic marine bacterium; its proteins may require different expression temperatures than E. coli proteins.

  • Salt concentration: As a marine bacterium, V. vulnificus proteins may require higher salt concentrations for optimal activity and stability.

  • Lipid environment: The natural membrane composition differs between E. coli and V. vulnificus, potentially affecting protein folding and activity.

  • Substrate specificity: V. vulnificus prelipoproteins may have different lipobox sequences or preferences compared to E. coli.

  • Buffer optimization: The pH optima and buffer preferences may differ between enzymes from different bacterial species.

  • Purification strategy: While affinity tags work across species, the optimal purification conditions may need adjustment for V. vulnificus Lgt.

These considerations acknowledge the biological differences between E. coli and V. vulnificus, ensuring that methodologies are appropriately adapted for successful V. vulnificus Lgt studies .

How does research on bacterial Lgt relate to vaccine development strategies?

Research on bacterial lipoprotein modification enzymes like Lgt has significant implications for vaccine development:

  • Adjuvant properties: Bacterial lipoproteins are recognized by Toll-like receptors (TLRs), particularly TLR2, and can act as natural adjuvants that enhance immune responses. Understanding the lipid modifications catalyzed by Lgt can inform the design of more effective adjuvants.

  • Attenuated vaccine strains: Conditional mutants of Lgt could potentially be used to develop attenuated bacterial strains with altered lipoprotein presentation for vaccine purposes.

  • Subunit vaccine design: Recombinant lipoproteins produced through controlled Lgt-mediated modification could serve as effective subunit vaccine components.

  • Mucosal immunity: Similar to flagellin (which has been shown to be a potent mucosal adjuvant), Lgt-modified lipoproteins could potentially enhance mucosal immune responses, which are critical for protection against pathogens like V. vulnificus that enter through mucosal surfaces .

  • Cross-protective antigens: Identifying conserved lipoproteins modified by Lgt across different V. vulnificus strains could lead to the development of broadly protective vaccines.

The flagellin research with V. vulnificus demonstrates that bacterial components can induce protective immune responses through TLR activation, suggesting similar potential for Lgt-modified lipoproteins .

How might genome size affect the evolution and function of Lgt in bacterial species?

Genome size and organization can significantly impact the evolution and function of enzymes like Lgt:

  • Genome expansion effects: As genomes expand, the load of deleterious mutations increases exponentially, potentially affecting essential genes like Lgt .

  • Lateral gene transfer (LGT): The effectiveness of LGT at purging deleterious mutations decreases with genome size, which may influence the evolution of genes like Lgt .

  • Recombination length: The benefits of LGT increase with recombination length, but there's no evidence that larger genome size is accompanied by increased recombination length .

  • Selection pressure: Essential genes like Lgt likely experience stronger purifying selection regardless of genome size, maintaining their functional integrity.

  • Gene duplication: Larger genomes may contain paralogs of Lgt with specialized functions, while smaller genomes typically maintain a single, highly conserved copy.

These genomic considerations provide insight into how Lgt may evolve differently across bacterial species with varying genome sizes, which could impact substrate specificity and catalytic efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.