Recombinant Vibrio vulnificus Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. For dry ice shipment, please inform us in advance, as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which serves as a reference for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize the development of your specified tag.
Synonyms
htpX; VV1332; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
htpX
Target Protein Sequence
MKRVMLFLITNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGAFISLMMSKG MALRSVGGMVIESPRNETEHWLLETVSRQAQQAGIGMPTVAIYDSPDINAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANMVAS NNSDEEGEGSNMMVYFAVSIALELVFGFLASFITMWYSRHREFHADAGAARLVGKEKMIA ALERLKMSQESKLDGTMMAFGINGKQSLTELLMSHPPLDKRIAALRNF
Uniprot No.

Target Background

Database Links

KEGG: vvy:VV1332

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Vibrio vulnificus HtpX protease and what is its primary function?

The HtpX protease in Vibrio vulnificus is a membrane-bound protease that appears to be involved in the cellular stress response pathway. Based on studies in related bacteria, HtpX likely functions as an intracellular protease involved in protein quality control mechanisms . In bacterial systems, HtpX has been characterized as playing a role in the degradation of misfolded membrane proteins, thereby maintaining cellular homeostasis under various stress conditions.

Unlike the heat shock protein HtpG, which has been confirmed to contribute to cold shock recovery in V. vulnificus , the specific environmental triggers and functional roles of HtpX in V. vulnificus are still being elucidated. Research in Pseudomonas aeruginosa has shown that htpX operates as an intracellular protease that responds to the accumulation of misfolded proteins , suggesting a similar function may exist in V. vulnificus.

How does the structure of Recombinant Vibrio vulnificus HtpX compare to similar proteases in other bacterial species?

While specific structural data for Vibrio vulnificus HtpX is limited in the provided search results, comparative analyses suggest potential structural similarities with HtpX proteases from related bacterial species. The HtpX protease likely contains conserved domains characteristic of membrane-bound zinc metalloproteases.

From comparative studies, we can infer that V. vulnificus HtpX may share functional domains with the better-characterized HtpX in other species like Escherichia coli and Pseudomonas aeruginosa . In P. aeruginosa, HtpX has been studied in the context of stress responses, revealing its role as an intracellular protease . The homology between V. vulnificus and other Vibrio species suggests potential structural conservation, much like the observed similarity in HtpG proteins where V. vulnificus shows 85% identity with V. cholerae HtpG .

What experimental approaches are most effective for expressing and purifying Recombinant Vibrio vulnificus HtpX?

Effective expression and purification of Recombinant Vibrio vulnificus HtpX requires a systematic approach to overcome challenges associated with membrane proteins. The following methodology is recommended:

  • Gene Cloning Strategy:

    • Identify and amplify the htpX gene from V. vulnificus genomic DNA using PCR with specific primers

    • Clone the amplified gene into an appropriate expression vector with a fusion tag (His-tag or GST-tag) to facilitate purification

    • Verify the construct by sequencing to ensure no mutations were introduced during cloning

  • Expression System Selection:

    • Use E. coli BL21(DE3) or similar strains optimized for recombinant protein expression

    • Consider specialized strains designed for membrane protein expression if initial attempts yield poor results

    • Optimize expression conditions including temperature (typically 16-25°C for membrane proteins), induction time, and inducer concentration

  • Membrane Protein Solubilization:

    • Extract membrane fractions through differential centrifugation

    • Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl β-D-maltoside or CHAPS)

    • Screen multiple detergents to identify optimal solubilization conditions

  • Purification Strategy:

    • Employ affinity chromatography based on the fusion tag

    • Follow with size exclusion chromatography to achieve higher purity

    • Verify purification through SDS-PAGE and Western blotting

Similar approaches have been successfully applied to other V. vulnificus proteins, such as the heat shock protein HtpG, which was identified, cloned, and characterized through molecular techniques .

How does the expression of htpX in Vibrio vulnificus change under different environmental stress conditions?

The expression of htpX in Vibrio vulnificus likely exhibits dynamic regulation in response to various environmental stressors, though direct evidence from the search results is limited specifically for V. vulnificus htpX. Drawing parallels from studies on other stress-responsive genes and related organisms provides valuable insights.

Research on Pseudomonas aeruginosa revealed variable htpX expression patterns in response to environmental conditions. Notably, in P. aeruginosa, htpX was not consistently upregulated in response to metal exposure, suggesting it may not participate in the general metal stress response pathway . This contrasts with other stress-responsive genes like sodA (superoxide dismutase) and mt (metallothionein), which showed significant upregulation in metal-contaminated environments .

For V. vulnificus specifically, we can design experimental approaches to monitor htpX expression under various stressors:

Environmental StressorHypothesized htpX ResponseMethodological Approach
Temperature shock (cold/heat)Potential upregulation during recovery phaseqRT-PCR analysis at different time points after temperature shift
Oxidative stressVariable expression based on stress intensityGene expression analysis with different H₂O₂ concentrations
pH stressPotential upregulation in acidic environmentsRNA-seq analysis under varying pH conditions
Nutrient limitationExpression changes during adaptation phaseComparative proteomics before and after nutrient depletion
Metal exposurePossibly minimal response based on P. aeruginosa dataQuantitative PCR similar to methods used for other bacteria

The regulation of stress response genes in V. vulnificus has been demonstrated to be complex and multifactorial, as seen with the htpG gene, which contributes specifically to cold shock recovery rather than cold shock tolerance .

What is the relationship between HtpX protease activity and Vibrio vulnificus virulence mechanisms?

The relationship between HtpX protease activity and Vibrio vulnificus virulence mechanisms represents a complex and understudied area. While direct evidence linking HtpX to V. vulnificus virulence is not explicitly presented in the search results, several connections can be inferred based on our understanding of bacterial stress responses and virulence.

V. vulnificus virulence has been strongly associated with capsular polysaccharide (CPS) expression and toxins such as hemolysin (VVH) . Stress response proteins like HtpX may indirectly influence virulence through several potential mechanisms:

  • Protein Quality Control During Host Infection:
    HtpX, as an intracellular protease, likely participates in degrading misfolded proteins during the stress of host invasion. This function would help maintain cellular homeostasis when the bacterium encounters the hostile host environment.

  • Adaptation to Environmental Transitions:
    V. vulnificus transitions from marine/estuarine environments to the human host during infection. Similar to how HtpG assists in cold shock recovery , HtpX may facilitate adaptation to temperature, pH, or other environmental shifts encountered during invasion.

  • Potential Regulation of Virulence Factor Expression:
    Stress response systems often crosslink with virulence regulation networks. HtpX could potentially influence the expression or activity of established virulence factors like CPS, which has been directly correlated with virulence in animal models .

To investigate these relationships, researchers should consider experimental designs that:

  • Create and characterize htpX deletion mutants in V. vulnificus

  • Compare virulence of wild-type and htpX mutants in appropriate animal models

  • Evaluate expression of known virulence factors in htpX mutants

  • Assess proteomic changes in htpX mutants during host cell interaction

Such approaches would mirror successful studies of other V. vulnificus factors, such as those that identified the correlation between CPS expression and virulence .

How can gene knockout and complementation studies be optimized to evaluate HtpX function in Vibrio vulnificus?

Optimizing gene knockout and complementation studies for evaluating HtpX function in Vibrio vulnificus requires careful experimental design and methodological considerations:

Knockout Strategy:

  • Selection of Mutagenesis Method:

    • Allelic exchange mutagenesis using suicide vectors (e.g., pDM4)

    • CRISPR-Cas9 systems adapted for Vibrio species

    • Transposon mutagenesis for initial screening

  • Confirmation of Knockout:

    • PCR verification of gene deletion

    • RT-PCR to confirm absence of transcript

    • Western blot to verify protein absence

    • Whole genome sequencing to confirm no off-target effects

  • Phenotypic Characterization:

    • Growth curves under standard and stress conditions

    • Survival assays under various stressors (temperature shifts, oxidative stress)

    • Proteome analysis to identify accumulation of potential HtpX substrates

Complementation Approach:

  • Vector Selection:

    • Use low to medium-copy plasmids to avoid overexpression artifacts

    • Consider chromosomal integration for physiological expression levels

  • Expression Control:

    • Use native promoters for physiological expression

    • Alternative: inducible promoters with titratable expression

    • Include proper transcriptional terminators

  • Verification of Complementation:

    • Western blot to confirm protein production

    • RT-qPCR to quantify expression levels

    • Functional assays to confirm activity restoration

This approach mirrors successful studies on other V. vulnificus genes, such as the htpG gene, where an isogenic mutant was constructed and phenotypic changes were evaluated during and after cold shock . The comparative analysis between wild-type, knockout, and complemented strains provided clear evidence for HtpG's role in cold shock recovery, demonstrating the effectiveness of this experimental design .

What analytical techniques are most appropriate for assessing the enzymatic activity of Recombinant Vibrio vulnificus HtpX?

Assessing the enzymatic activity of Recombinant Vibrio vulnificus HtpX requires specialized techniques appropriate for membrane-bound proteases. The following analytical approaches are recommended:

  • Substrate-Based Activity Assays:

    • Fluorogenic peptide substrates containing HtpX cleavage sites

    • FRET-based assays using peptides with fluorophore-quencher pairs

    • In vitro proteolysis assays using purified potential substrate proteins

  • Kinetic Analysis:

    • Determination of Michaelis-Menten parameters (Km, Vmax)

    • Inhibition studies using protease inhibitors to confirm mechanism

    • pH and temperature optima determination

  • Structural Analysis of Enzyme-Substrate Interactions:

    • Molecular docking simulations to predict substrate binding

    • Site-directed mutagenesis of predicted catalytic residues

    • Differential scanning fluorimetry to assess thermal stability

  • In Vivo Activity Assessment:

    • Reporter systems fused to potential substrates

    • Proteomics comparison between wild-type and htpX mutant strains

    • Pulse-chase experiments to monitor protein degradation in vivo

A typical experimental workflow might include:

PhaseMethodOutcome Measurement
Initial Activity ScreeningFluorogenic substrate panelRelative fluorescence units
OptimizationVarying pH, temperature, ionic conditionsActivity heat maps
Kinetic CharacterizationSubstrate concentration seriesKm, Vmax, kcat values
Inhibitor StudiesZn²⁺ chelators, site-specific inhibitorsIC₅₀ values
Substrate IdentificationMass spectrometry of digestion productsCleavage site mapping

These analytical approaches can be adapted from studies of similar bacterial proteases and would provide comprehensive characterization of HtpX enzymatic properties.

How does the gene expression profile of htpX compare with other stress response genes in Vibrio vulnificus?

Comparative analysis of htpX expression with other stress response genes in Vibrio vulnificus provides valuable insights into the bacterium's stress response network. While direct comparative data for V. vulnificus htpX is limited in the search results, we can draw inferences from related studies.

In Pseudomonas aeruginosa, researchers observed differential expression patterns among stress-responsive genes. Unlike sodA and mt genes, which showed significant upregulation in response to metal contamination, htpX expression was more variable and did not consistently increase under metal stress . This suggests htpX may respond to different stress signals than other stress-related genes.

A comprehensive gene expression comparison would likely reveal:

GenePrimary Stress ResponseExpression PatternFunctional Role
htpXProtein misfoldingLikely constitutive with condition-specific inductionMembrane protein quality control
htpGTemperature stressUpregulated during recovery from cold shock Molecular chaperone facilitating refolding
sodAOxidative stressStrong correlation with metal contamination Superoxide radical detoxification
mtMetal exposureSignificantly elevated in contaminated environments Metal sequestration and detoxification
vvhAHost-associated stressRegulated by environmental factors Virulence (hemolysin production)

To accurately map the htpX expression profile relative to other stress genes in V. vulnificus, researchers should employ:

  • RNA-seq analysis under various stress conditions

  • qRT-PCR validation of key gene expression patterns

  • Promoter-reporter fusion studies to visualize expression dynamics

  • Proteomics to correlate transcript and protein levels

These approaches would build upon methodologies successfully employed in studies like those that characterized the differential expression of stress response genes in P. aeruginosa .

What are the most promising future research directions for understanding the role of HtpX in Vibrio vulnificus biology?

Future research on HtpX in Vibrio vulnificus should focus on several promising directions that would significantly advance our understanding of this protease's role in bacterial physiology and pathogenesis:

  • Substrate Identification and Characterization:

    • Employ proteomics approaches to identify natural substrates of HtpX in V. vulnificus

    • Characterize substrate specificity through systematic peptide library screening

    • Develop in vivo substrate trapping methods to capture physiologically relevant interactions

  • Regulatory Network Mapping:

    • Characterize the transcriptional and post-transcriptional regulation of htpX

    • Identify environmental and host signals that modulate htpX expression

    • Map interactions between HtpX-mediated proteolysis and other stress response pathways

  • Host-Pathogen Interaction Studies:

    • Evaluate the impact of htpX deletion on V. vulnificus virulence in animal models

    • Investigate potential roles of HtpX in immune evasion and survival within host cells

    • Determine whether HtpX activity affects production of virulence factors like CPS or VVH

  • Therapeutic Target Assessment:

    • Develop specific inhibitors of HtpX protease activity

    • Evaluate the potential of HtpX inhibition to attenuate V. vulnificus infections

    • Assess HtpX as a potential vaccine candidate or diagnostic marker

  • Comparative Biology Approaches:

    • Expand studies to compare HtpX function across multiple Vibrio species

    • Evaluate evolutionary conservation and divergence of HtpX proteases

    • Develop systems biology models of stress response networks including HtpX

These research directions build upon existing knowledge of stress response mechanisms in V. vulnificus and related bacteria , while addressing the critical gaps in our understanding of HtpX specifically. Integration of modern genomic, proteomic, and computational approaches with rigorous experimental design principles will be essential for advancing this field.

How can researchers effectively integrate in vivo and in vitro approaches to comprehensively characterize the function of Vibrio vulnificus HtpX?

Effectively integrating in vivo and in vitro approaches for comprehensive characterization of Vibrio vulnificus HtpX requires a multi-faceted research strategy that connects biochemical properties with biological functions:

Coordinated Research Framework:

  • Initial Biochemical Characterization:

    • Purify recombinant HtpX using optimized expression systems

    • Determine enzymatic parameters (substrate specificity, cofactor requirements)

    • Perform structural analyses (crystallography or cryo-EM if possible)

  • Transition to Cellular Systems:

    • Develop cell-based assays for HtpX activity using reporter substrates

    • Create V. vulnificus strains with tagged HtpX to monitor localization and interactions

    • Perform comparative proteomics between wild-type and htpX mutants

  • In Vivo Validation:

    • Generate targeted htpX mutants to assess phenotypic consequences

    • Evaluate stress tolerance profiles under various environmental conditions

    • Test virulence in appropriate infection models

Integration Strategies:

In Vitro ObservationCorresponding In Vivo ValidationIntegration Method
Substrate specificity profileProteome changes in htpX mutantTargeted proteomics for predicted substrates
Optimal pH for enzymatic activityGrowth/survival in various pH environmentsCorrelation of enzyme activity with in vivo fitness
Structure-function relationshipsComplementation with site-directed mutantsPhenotypic rescue analysis
Inhibitor effectiveness in vitroInhibitor effects on bacterial physiologyPharmacological validation in cellular models

This integrated approach mirrors successful studies of other bacterial systems, such as the work on V. vulnificus htpG that combined gene deletion with phenotypic characterization to establish its role in cold shock recovery . Similarly, researchers studying P. aeruginosa stress responses effectively integrated molecular techniques with environmental studies to understand gene function in context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.