Recombinant Vibrio vulnificus Universal Stress Protein B Homolog (uspB) refers to a bioengineered protein derived from Vibrio vulnificus, a Gram-negative bacterium associated with severe human infections. The recombinant form is produced in Escherichia coli, with a His-tag added for purification purposes. Key structural and functional attributes include:
The amino acid sequence of V. vulnificus uspB is:
MINGDIILFALMVVTGVNLARYLTALRSLIYIMREAHPLLYQQVDGNGFFTTHGNVTKQVRLYHYLKSKEYHHHHDEVFTGKCDRVRELFVLSVSLTGVTLLAAFLL .
In E. coli, uspB is σS-dependent and critical for stationary-phase resistance to ethanol. While direct evidence for V. vulnificus uspB is limited, its homology suggests similar roles in:
Stress Tolerance: Modulating responses to osmotic, thermal, or oxidative stress .
Pathogenicity: Potential involvement in survival within hostile host environments, though V. vulnificus stressosome mutants (including uspB) show no significant phenotype in nutrient-rich media .
The recombinant uspB protein is expressed in E. coli and purified via affinity chromatography (His-tag). This process ensures high purity and compatibility with downstream biochemical assays .
| Parameter | Details | Source |
|---|---|---|
| Expression Host | E. coli | |
| Purification Method | Nickel-affinity chromatography | |
| Stability | Stable at 4°C for ≤1 week; long-term storage at -20°C/-80°C with glycerol |
Stress Response Studies: Used to investigate V. vulnificus survival mechanisms under stress conditions (e.g., ethanol, osmotic shock) .
Structural Analysis: Provides material for crystallization or NMR studies to resolve USP family dynamics .
Vaccine Development: Potential antigen for immunological studies targeting V. vulnificus virulence factors .
Current studies highlight the need for:
Functional Validation: Direct evidence of V. vulnificus uspB’s role in stress response or pathogenicity.
Stressosome Context: Clarifying its interaction with the stressosome complex, which remains non-essential in nutrient-rich media .
Therapeutic Targeting: Exploring its utility in antimicrobial strategies, given V. vulnificus’ rising antibiotic resistance .
KEGG: vvy:VV0076
Universal stress protein B homolog (uspB) in Vibrio vulnificus belongs to the universal stress protein (USP) superfamily, a group of conserved proteins that are expressed under various environmental stressors. While specific structural data for V. vulnificus uspB is limited, this protein likely contains the characteristic USP domain with a conserved ATP-binding motif. The uspB protein is expected to function similarly to other stress response proteins in V. vulnificus, helping the bacterium adapt to adverse environmental conditions. Based on comparative analysis with the V. vulnificus stressosome complex, uspB may be involved in sensing environmental stressors and triggering downstream adaptive responses . The protein likely participates in the bacterium's stress response network, working alongside other stress sensors like the stressosome to ensure bacterial survival under challenging conditions.
For optimal recombinant expression of V. vulnificus uspB, consider the following protocol:
Vector selection: Use pET-based expression vectors for high-level expression in E. coli.
Host strain selection: BL21(DE3) or its derivatives are recommended for uspB expression, similar to methods used for other V. vulnificus proteins .
Induction conditions: Optimize IPTG concentration (0.1-1.0 mM) and induction temperature (16-30°C).
Solubility enhancement: Add solubility tags (MBP, SUMO, or GST) if initial expression yields insoluble protein.
Purification strategy: Implement a two-step purification using affinity chromatography followed by size exclusion chromatography.
This approach is based on successful expression strategies for other V. vulnificus proteins, including stress response factors. For example, similar approaches were successfully applied in studies of V. vulnificus RpoS expression systems, where careful optimization of expression conditions proved critical for obtaining functional protein .
Verify the structural integrity of recombinant uspB using this comprehensive analytical workflow:
SDS-PAGE: Confirm protein purity and apparent molecular weight.
Western blot: Verify protein identity using anti-His tag antibodies or custom uspB antibodies.
Circular dichroism (CD): Assess secondary structure composition and thermal stability.
Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine oligomeric state and homogeneity.
Mass spectrometry: Confirm protein mass and identify post-translational modifications.
Limited proteolysis: Evaluate domain organization and stability.
These methods collectively provide a robust assessment of protein quality before functional studies. Similar approaches have been effectively used to characterize other V. vulnificus stress response proteins, such as those in the stressosome complex .
Based on studies of similar stress response systems in V. vulnificus, uspB expression likely varies significantly under different environmental conditions:
| Environmental Condition | Expected uspB Expression | Experimental Verification Method |
|---|---|---|
| Oxygen limitation | Increased expression | qRT-PCR, Western blot |
| Iron starvation | Increased expression | Reporter fusion assays |
| Temperature stress (42°C) | Significantly elevated | Proteomics analysis |
| High salinity | Moderately elevated | RNA-seq |
| Acidic pH | Increased expression | Luciferase reporter assays |
This expression pattern would be consistent with observations of other stress response proteins in V. vulnificus, particularly those involved in oxygen sensing and iron metabolism regulation . The stressosome complex in V. vulnificus has been shown to respond to oxygen levels and participate in regulating iron metabolism, suggesting uspB may exhibit similar regulatory patterns as part of the broader stress response network. Verification of these patterns requires experimental confirmation using the methods indicated in the table.
Universal stress protein B homolog likely contributes to V. vulnificus pathogenicity through several mechanisms:
Stress adaptation: uspB may enhance bacterial survival in the host environment by responding to host-induced stresses similar to how the stressosome complex senses oxygen limitation .
Virulence regulation: Like other stress proteins in V. vulnificus, uspB may regulate virulence factor expression. This is supported by evidence that stress response pathways in V. vulnificus, including RpoS-mediated pathways, control virulence factor expression .
Host colonization: uspB might facilitate adaptation to varying oxygen tensions and iron availability encountered during host colonization, similar to how the V. vulnificus stressosome modulates iron metabolism .
Immune evasion: The protein may contribute to survival during immune cell encounters by enabling adaptation to oxidative stress.
To experimentally verify these relationships, researchers should consider developing uspB deletion mutants and performing comparative virulence assays in mouse models, similar to approaches used to identify other virulence-associated genes in V. vulnificus .
Although direct evidence of uspB interaction with the V. vulnificus stressosome complex remains to be established, several investigative approaches can be employed:
Co-immunoprecipitation (Co-IP): Using antibodies against VvRsbR or VvRsbS components of the stressosome, researchers can determine if uspB co-precipitates, indicating physical interaction. This approach has successfully demonstrated the interaction between VvRsbR and VvRsbS in vivo .
Bacterial two-hybrid assay (BACTH): This technique has proven effective for confirming stressosome protein interactions in V. vulnificus between VvRsbR, VvRsbS, and VvRsbT . The same methodology can be applied to test uspB interactions.
Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics between uspB and stressosome components.
Fluorescence resonance energy transfer (FRET): To visualize protein interactions in live bacterial cells.
Cryo-electron microscopy: To determine potential structural integration of uspB into the stressosome complex, building on the existing structural data of the VvRsbR:VvRsbS stressosome complex .
Research has shown that the V. vulnificus stressosome functions as an oxygen sensor involved in modulating iron metabolism. If uspB interacts with this complex, it might participate in this oxygen-sensing mechanism or provide additional stress-sensing capabilities to the complex .
Based on established research on V. vulnificus stress responses and iron metabolism regulation, the following methodological approach is recommended:
Gene deletion studies: Create ΔuspB mutants following established protocols for V. vulnificus gene deletion, such as those used for constructing Δcya and ΔcpdA strains . Compare iron uptake and utilization between wild-type and mutant strains.
Transcriptomic analysis: Implement RNA-seq to compare expression profiles of iron acquisition genes (siderophore biosynthesis, iron transporters) between ΔuspB mutants and wild-type under iron-limiting conditions.
Siderophore production assays: Quantify siderophore production using Chrome Azurol S (CAS) assays in wild-type and uspB mutants.
55Fe uptake assays: Measure iron acquisition directly using radioactive iron uptake experiments.
Protein interaction studies: Use pull-down assays to identify interactions between uspB and iron regulatory proteins such as Fur (ferric uptake regulator).
In vivo infection models: Test virulence of ΔuspB mutants in iron-depleted mouse models to assess the importance of uspB in iron acquisition during infection.
This approach builds on evidence that the V. vulnificus stressosome is involved in modulating iron metabolism and would determine whether uspB plays a complementary or redundant role in this critical process for pathogenicity.
When facing contradictory results regarding uspB function in virulence, implement this systematic resolution framework:
Strain variation analysis: Sequence the uspB gene and its regulatory elements across multiple V. vulnificus strains, as genetic recombination has been observed in other virulence factors such as MARTX(Vv) toxin, leading to functional variations . This is particularly important given evidence of significant genetic rearrangement in key V. vulnificus virulence factors .
Experimental condition standardization:
Growth medium composition (particularly iron concentration)
Growth phase at harvest (early exponential vs. stationary)
Oxygen tension during growth
Temperature conditions
Multiple virulence model testing:
Compare results across different infection models (cell culture, mouse, invertebrate)
Test both septicemia and wound infection models
Vary inoculation routes (intragastric, intraperitoneal, subcutaneous)
Compensatory mechanisms investigation: Examine potential redundancy with other stress proteins using double/triple knockout approaches.
Bioinformatic re-evaluation: Apply genome-wide association studies (GWAS) and genome-wide epistasis studies (GWES) approaches similar to those used to identify other V. vulnificus virulence genes .
Meta-analysis: Systematically compare methodologies across contradictory studies to identify procedural variables affecting outcomes.
This comprehensive approach accounts for the genetic plasticity observed in V. vulnificus virulence factors and the complex regulatory networks involved in stress response and pathogenicity .
For comprehensive in vivo analysis of uspB protein-protein interactions, employ these advanced techniques:
Proximity-dependent biotin identification (BioID): Fuse uspB to a biotin ligase to biotinylate nearby proteins in living V. vulnificus cells. This approach allows for identification of transient interactions and has advantages over traditional Co-IP methods that have been used successfully for stressosome components in V. vulnificus .
Split fluorescent protein complementation: Fuse candidate interaction partners with complementary fragments of a fluorescent protein to visualize interactions in real-time during infection or stress exposure.
CRISPR interference (CRISPRi) combination screens: Systematically repress expression of candidate interaction partners while monitoring uspB function to identify functional relationships.
Protein-fragment complementation assays (PCA): Apply similar principles to those used in bacterial two-hybrid assays that successfully detected interactions between stressosome components , but with the advantage of working in the native V. vulnificus context.
Single-molecule tracking: Use fluorescently tagged uspB to track its localization and co-localization with other proteins during stress responses.
Cross-linking mass spectrometry (XL-MS): Apply chemical cross-linking followed by mass spectrometry to capture and identify interacting proteins in their native cellular environment.
These approaches overcome limitations of traditional in vitro methods and provide spatial and temporal information about uspB interactions during actual stress responses, building upon successful interaction studies of other V. vulnificus stress response proteins .
Based on knowledge of RpoS regulation in V. vulnificus , the following comprehensive approach is recommended for characterizing uspB transcriptional regulation:
Promoter mapping:
Transcriptional fusion assays:
Chromatin immunoprecipitation (ChIP):
Perform ChIP-seq with anti-RpoS antibodies to determine if RpoS directly binds the uspB promoter
Identify other transcription factors binding to the uspB regulatory region
Electrophoretic mobility shift assays (EMSA):
Regulatory network mapping:
Compare transcriptomes of wild-type and ΔuspB strains under various stress conditions
Identify overlap with the RpoS regulon
This approach builds on established methodologies that successfully characterized the RpoS regulatory network in V. vulnificus, including the discovery of cAMP-CRP as a direct repressor of RpoS expression .
When designing uspB knockout experiments, researchers should implement these critical methodological considerations:
Knockout strategy selection:
Complementation controls:
Plasmid-based complementation with native promoter
Chromosomal restoration of the wild-type gene
Expression from an inducible promoter for dose-response studies
Phenotypic validation panel:
Growth curves under multiple stress conditions
Stress survival assays (acid, oxidative, osmotic stress)
Biofilm formation quantification
Motility assessment
Virulence in infection models
Gene expression verification:
qRT-PCR confirmation of uspB deletion
RNA-seq to identify compensatory changes in gene expression
Western blot analysis to confirm protein absence
Potential pitfalls and solutions:
Genetic instability: Verify mutant stability through multiple passages
Compensatory mutations: Sequence genome of knockout strain
Strain background effects: Create knockouts in multiple V. vulnificus strains
These approaches build on successful genetic manipulation strategies applied to other V. vulnificus genes, including stress response regulators and virulence factors .
For optimal structural and functional characterization of recombinant uspB, implement this comprehensive workflow:
Structural analysis approaches:
X-ray crystallography: Optimize crystallization conditions using vapor diffusion methods
Cryo-electron microscopy: Particularly useful if uspB forms larger complexes similar to the V. vulnificus stressosome
Nuclear magnetic resonance (NMR): For dynamic structural analysis
Small-angle X-ray scattering (SAXS): To analyze solution structure
Functional characterization methods:
ATPase activity assays: Measure ATP hydrolysis rates under various stress conditions
Thermal shift assays: Determine stabilizing ligands and conditions
Isothermal titration calorimetry (ITC): Quantify binding to potential interaction partners
Fluorescence-based ligand binding assays: Identify small molecule interactions
Protein modification analysis:
Phosphorylation state analysis using Phos-tag gels and mass spectrometry
Redox state characterization using non-reducing gels
Post-translational modification mapping by mass spectrometry
In vitro reconstitution experiments:
Reconstitute uspB with stressosome components to test functional interactions
Examine effects on gene expression using in vitro transcription systems
This systematic approach builds on successful structural and functional studies of other V. vulnificus proteins, including the groundbreaking structural characterization of the stressosome complex by cryo-electron microscopy .
Understanding the role of uspB in V. vulnificus virulence has significant clinical implications:
Diagnostic applications:
Development of uspB-based molecular diagnostics for rapid detection of virulent strains
Biomarker potential for predicting infection severity based on uspB variants
Clinical isolate characterization:
Host-pathogen interaction insights:
Understanding how uspB contributes to survival in human tissues
Identification of specific host stressors that trigger uspB-mediated responses
Treatment implications:
Assessment of uspB expression during antibiotic treatment
Potential for targeting uspB or its regulated pathways to enhance antibiotic efficacy
Personalized medicine approach:
Linking patient risk factors (e.g., immunocompromised status, liver disease) with uspB-mediated virulence mechanisms
Development of targeted therapies based on uspB function
This research direction is supported by clinical cases demonstrating the severity of V. vulnificus infections and the challenges in treating them, as documented in patient case studies where aggressive treatment by infectious disease specialists was required .
Evaluation of uspB as a therapeutic target should follow this systematic drug discovery workflow:
Target validation phase:
Confirm essentiality or significant virulence contribution through in vivo infection models
Demonstrate attenuated pathogenicity in uspB mutants across multiple infection routes
Verify absence of mammalian homologs to minimize off-target effects
High-throughput screening strategy:
Develop activity-based assays for uspB function
Screen chemical libraries for inhibitors of:
uspB expression
Protein-protein interactions with stress response partners
ATP binding/hydrolysis activity
Lead compound optimization:
Structure-activity relationship (SAR) studies based on uspB crystal structure
Medicinal chemistry optimization for pharmacokinetic properties
Testing in increasingly complex models (cell-based → animal models)
Combination therapy assessment:
Evaluate synergy with current antibiotics
Test with other virulence inhibitors targeting complementary pathways
Resistance development analysis:
Long-term exposure studies to assess resistance development
Genetic barrier analysis for potential escape mutations
This approach aligns with current efforts to identify new therapeutic targets against V. vulnificus, as suggested by genomic studies that identified potential targets for vaccine development , and addresses the urgent need for better treatments highlighted by clinical case reports .
The next decade of uspB research will likely be transformed by these emerging technologies:
Single-cell approaches:
Single-cell RNA-seq to capture heterogeneity in uspB expression within bacterial populations
Single-cell proteomics to analyze protein-level responses
Microfluidic devices for real-time observation of uspB expression during host cell interactions
Advanced imaging techniques:
Super-resolution microscopy for visualizing uspB localization at nanoscale resolution
Live-cell imaging using new fluorescent proteins with improved properties
Correlative light and electron microscopy (CLEM) to connect uspB localization with ultrastructural features
Computational advances:
AlphaFold and related AI systems for accurate uspB structure prediction
Molecular dynamics simulations of uspB interactions at longer timescales
Systems biology modeling of uspB in the context of the entire stress response network
High-throughput functional genomics:
CRISPR interference screens at genome scale to identify genes affecting uspB function
Transposon sequencing (Tn-seq) under various stress conditions relevant to infection
Host-pathogen interaction models:
Organoid infection models to study uspB role in tissue-specific contexts
Humanized mouse models for improved clinical relevance
These technological advances will build upon current research foundations, including the structural studies of stress response complexes and genetic approaches to identifying virulence determinants , while enabling more precise understanding of uspB's role in pathogenesis.
Based on observed patterns in other V. vulnificus virulence factors, uspB genetic variation likely has significant functional implications:
Expected patterns of variation:
Functional consequences to investigate:
Strain-specific differences in stress tolerance profiles
Altered protein-protein interaction networks
Modified ATP binding or hydrolysis capabilities
Differential regulation by global regulators
Methodological approach to characterization:
Comparative genomics across clinical and environmental isolates
Phenotypic profiling of strains with variant uspB alleles
Experimental evolution under stress conditions to identify adaptive mutations
Generation of chimeric uspB proteins to map functional domains
Virulence implications: