Recombinant Vibrio vulnificus UPF0208 membrane protein VV2132 (VV2132)

Shipped with Ice Packs
In Stock

Description

General Information

Vibrio vulnificus is a marine bacterium known to cause severe infections, particularly in individuals with compromised immune systems or pre-existing conditions like liver disease and iron overload . The ability of V. vulnificus to acquire iron from its host is linked to its virulence . It can utilize iron sources such as hemoglobin and heme .

VV2132 is a protein that belongs to the UPF0208 family, which stands for "Unknown Protein Function" . Proteins in this family have a conserved amino acid sequence but their exact function is not yet known.

Basic Information of VV2132

PropertyValue
Chemical NameRecombinant Vibrio vulnificus UPF0208 membrane protein VV2132 (VV2132)
CBNumberCB015639855
Molecular Weight0
MDL Number
MOL FileMol file

Structure and Function

VV2132 is a membrane protein, which means it is located in the cell membrane of V. vulnificus . More specifically, it is an outer membrane protein . Outer membrane proteins are important for the interaction of bacteria with their environment. They can be involved in nutrient transport, cell adhesion, and defense against harmful substances .

Role in Virulence

While the specific function of VV2132 is currently unknown, its nature as an outer membrane protein suggests a role in the virulence of V. vulnificus. Research has shown that outer membrane proteins in bacteria can directly influence antimicrobial resistance mechanisms and virulence .

One well-characterized outer membrane protein of Vibrio species is OmpU, which contributes to antimicrobial peptide resistance and is required for virulence in oysters .

Expression and Regulation

The expression of some outer membrane proteins in V. vulnificus is regulated by iron . For example, the expression of HupA, a heme receptor, is strongly regulated by iron, with transcription being repressed under high-iron conditions . A fur mutant of V. vulnificus constitutively expresses certain iron-regulated outer membrane proteins .

Lysine Acetylation in V. vulnificus

A study on V. vulnificus Vv180806 identified a large number of acetylated proteins, suggesting a significant role for acetylation in this bacterium . Acetylation is a post-translational modification that can affect protein function . The study identified 6,626 high-confidence acetylation sites on 1,924 proteins, representing over 40% of the total proteins in the strain .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VV2132; UPF0208 membrane protein VV2132
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
VV2132
Target Protein Sequence
MNNKVGLAHSLRDGQKYMDTWPMRKELSAIFPEQRIIKATRFGIKVMPAIAAISVLTQMA FNNYQALPQAIVMALFALSLPLQGMWWLGHRSNTQLPPALATWYRELHQKIVESGSALEP LKSRPRYKELAHTLNRAFRHLDKSALERWF
Uniprot No.

Target Background

Database Links

KEGG: vvy:VV2132

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental considerations are important when working with lyophilized VV2132 protein?

When working with lyophilized VV2132 protein, several critical experimental considerations must be addressed to maintain protein integrity:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended for optimal stability)

Storage Conditions:

  • Store reconstituted protein at -20°C/-80°C for extended storage

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein stability

Buffer Composition:

  • Tris-based buffer systems with pH 8.0 maintain VV2132 stability

  • The addition of 6% trehalose acts as a cryoprotectant for preserving protein structure during freeze-thaw processes

These considerations are essential for researchers to obtain reliable and reproducible results in downstream applications. Proper handling ensures that the structural and functional integrity of VV2132 is preserved throughout experimental procedures.

How can researchers validate the structural integrity of purified VV2132 prior to functional studies?

Validating the structural integrity of purified VV2132 is critical before proceeding with functional studies. A comprehensive validation approach should include:

Purity Assessment:

  • SDS-PAGE analysis to confirm >90% purity as a minimum acceptance criterion

  • Western blot verification using anti-His antibodies (for His-tagged variants) to confirm identity

Biophysical Characterization:

  • Circular Dichroism (CD) spectroscopy to evaluate secondary structure elements characteristic of membrane proteins

  • Dynamic Light Scattering (DLS) to assess protein homogeneity and detect potential aggregation

  • Thermal shift assays to determine protein stability and optimal buffer conditions

Functional Validation:

  • Lipid binding assays to confirm proper membrane association properties

  • Pilot interaction studies if potential binding partners have been identified

Structural Analysis:

  • Negative stain electron microscopy for preliminary structural assessment and homogeneity evaluation

  • Size Exclusion Chromatography to verify the oligomeric state of the protein

Implementing these validation steps ensures that subsequent functional studies are performed with structurally intact protein, significantly increasing the reliability of experimental outcomes and interpretations. Particular attention should be paid to confirming membrane protein characteristics, as improper folding can drastically affect functional properties.

What experimental design approaches are most appropriate for investigating VV2132 function?

When designing experiments to investigate VV2132 function, researchers should implement a systematic approach following established experimental design principles:

Variable Definition:

  • Independent variables: Protein concentration, buffer conditions, temperature, pH, interaction partners

  • Dependent variables: Membrane binding, structural stability, protein-protein interactions, cellular effects

  • Control variables: Must be rigorously maintained to ensure experimental validity

Experimental Design Types:

  • Pre-experimental designs:

    • One-shot case study: Apply VV2132 to a system and test outcomes

    • One-group pretest-posttest: Measure parameters before and after VV2132 introduction

  • Quasi-experimental designs:

    • Particularly useful when random assignment is not possible, such as when working with clinical isolates

  • True experimental designs:

    • Posttest-only control group: Compare systems with and without VV2132

    • Pretest-posttest control group: Measure effects before and after VV2132 introduction while maintaining control groups

    • Solomon four-group design: Most comprehensive approach incorporating all permutations of control and experimental conditions

Methodological Framework:

  • Define a specific, testable hypothesis about VV2132 function

  • Select appropriate experimental and control groups

  • Determine precise measurement protocols for dependent variables

  • Implement controls for confounding variables

  • Establish statistical analysis approach before experimentation

This structured approach to experimental design will help researchers systematically investigate the unknown function of VV2132, minimizing bias and maximizing the reliability of findings.

How should genetic studies be designed to investigate VV2132 variation across Vibrio vulnificus strains?

Investigating VV2132 variation across Vibrio vulnificus strains requires a robust genetic study design that builds on successful approaches used for other V. vulnificus virulence factors:

Sampling Strategy:

  • Include diverse isolates representing:

    • Clinical sources (patient isolates)

    • Environmental sources (seawater, sediment, shellfish)

    • Geographic diversity

    • Temporal diversity (historical and recent isolates)

  • Aim for at least 40 strains for meaningful variation analysis, similar to successful studies of MARTX Vv toxin variants

Sequencing Methodology:

  • PCR amplification of the entire VV2132 gene using conserved flanking primers

  • Bidirectional Sanger sequencing for accurate variant identification

  • Whole genome sequencing for broader genomic context when possible

Bioinformatic Analysis:

  • Multiple sequence alignment to identify conserved and variable regions

  • Phylogenetic analysis to establish evolutionary relationships between variants

  • Recombination detection algorithms to identify potential gene exchange events

  • Selection pressure analysis (dN/dS ratios) to identify regions under selection

Variant Characterization:

  • Clone identified variants for recombinant expression

  • Perform comparative biochemical characterization

  • Correlate variants with strain characteristics (virulence, environmental adaptation)

Functional Validation:

  • Generate isogenic strains expressing different VV2132 variants

  • Compare phenotypes related to membrane function

  • Assess impact on environmental fitness and potential virulence

This approach parallels successful studies of rtxA1 gene variants in V. vulnificus, where genetic recombination led to toxins with different effector domain arrangements and altered virulence potential . Similar mechanisms may drive VV2132 evolution, potentially affecting membrane properties or interactions with host factors.

What control measures should be implemented when studying potential roles of VV2132 in Vibrio vulnificus pathogenesis?

When investigating the potential role of VV2132 in Vibrio vulnificus pathogenesis, implementing rigorous control measures is essential to ensure reliable and interpretable results:

Genetic Controls:

  • Complementation Controls:

    • Include wild-type complementation of VV2132 deletion mutants

    • Engineer point mutations in functional domains for structure-function analysis

    • Create chimeric proteins with domains from related proteins to identify functional regions

  • Multiple Strain Background Controls:

    • Test knockout effects in both clinical and environmental isolates

    • Evaluate effects in different V. vulnificus lineages (I and II) as pathogenic potential varies between these groups

Experimental Controls:

  • Positive Controls:

    • Include experiments with known virulence factors (MARTX, VvhA) for comparison

    • Use established pathogenesis models with predictable outcomes

  • Negative Controls:

    • Include knockouts of non-virulence associated genes

    • Use non-pathogenic Vibrio species as comparative models

  • Vehicle Controls:

    • Include buffer-only and irrelevant protein controls in cell culture experiments

    • Employ mock infection controls in animal models

Methodological Controls:

  • Dose-Response Assessment:

    • Test multiple concentrations/doses to establish threshold effects

    • Evaluate time-course responses to distinguish primary from secondary effects

  • Multiple Readout Systems:

    • Combine different virulence assessment methodologies

    • Employ both in vitro cell culture and in vivo animal models

    • Use multiple cell types to avoid cell-specific artifacts

  • Environment Variation:

    • Test under different conditions mimicking host environments (temperature, pH, iron availability)

    • Include conditions that activate different virulence programs

These comprehensive control measures will help distinguish specific VV2132 effects from general bacterial responses or experimental artifacts, providing more reliable insights into any pathogenesis-related functions. This approach has been successfully applied to characterize other Vibrio vulnificus virulence factors like MARTX toxins and VvhA hemolysin .

How can structural biology approaches be optimized for VV2132 membrane protein characterization?

Structural characterization of membrane proteins like VV2132 presents unique challenges that require specialized approaches. The following methodological framework optimizes structural biology studies of VV2132:

X-ray Crystallography Optimization:

  • Construct Engineering:

    • Design truncation variants removing flexible regions

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

    • Introduce surface mutations to promote crystal contacts

  • Crystallization Strategies:

    • Implement lipidic cubic phase (LCP) crystallization

    • Screen detergent:lipid ratios systematically

    • Utilize bicelles or nanodiscs for near-native membrane environment

Cryo-Electron Microscopy Approaches:

  • Sample Preparation:

    • Reconstitute in nanodiscs with defined lipid composition

    • Optimize grid preparation with detergent screening

    • Apply GraFix technique to stabilize protein complexes

  • Data Collection Strategy:

    • Implement phase plates for improved contrast

    • Collect tilt series to address preferred orientation issues

    • Utilize energy filters to enhance signal-to-noise ratio

Solution NMR Techniques:

  • Isotope Labeling:

    • Express with selective labeling schemes (15N, 13C, 2H)

    • Implement amino acid-specific labeling for assignment

    • Use segmental labeling for larger constructs

  • Membrane Mimetics:

    • Optimize detergent micelles for spectral quality

    • Test bicelles of varying q-factors

    • Employ nanodiscs with different MSP constructs

Integrative Approaches:

  • Computational Integration:

    • Build homology models based on UPF0208 family members

    • Refine with molecular dynamics simulations

    • Validate with experimental constraints

  • Hybrid Methods:

    • Combine low-resolution EM with high-resolution X-ray data

    • Integrate mass spectrometry data (HDX-MS, cross-linking)

    • Incorporate SAXS/SANS for solution conformation validation

VV2132's relatively small size (150 amino acids) makes it amenable to multiple structural approaches. The determined structure would provide critical insights into this poorly characterized membrane protein family and potentially reveal functional mechanisms relevant to Vibrio vulnificus biology.

How can recombinant VV2132 be utilized in immunological studies of Vibrio vulnificus?

Recombinant VV2132 offers valuable opportunities for immunological investigations of Vibrio vulnificus, drawing on successful approaches used with other V. vulnificus proteins like VvhA:

Antibody Development:

  • Polyclonal Antibody Production:

    • Immunize animal models with purified recombinant VV2132

    • Characterize antibody specificity via Western blot and ELISA

    • Apply for detection in bacterial lysates and during infection conditions

  • Monoclonal Antibody Generation:

    • Screen hybridoma clones against different regions of VV2132

    • Select antibodies recognizing native conformations

    • Develop assays requiring high specificity detection

Immunological Research Applications:

  • Expression Analysis:

    • Track VV2132 expression under different environmental conditions

    • Investigate regulation during host-pathogen interactions

    • Compare expression across different V. vulnificus strains

  • Localization Studies:

    • Determine subcellular localization via immunofluorescence

    • Examine surface accessibility through flow cytometry

    • Characterize membrane domain association

  • Host Response Characterization:

    • Assess ability to stimulate innate immune responses

    • Evaluate potential for adaptive immune recognition

    • Compare with known immunogenic V. vulnificus proteins

Vaccine Research Potential:

  • Immunization Studies:

    • Evaluate VV2132 as a potential vaccine candidate

    • Characterize immune responses (antibody titers, T-cell activation)

    • Assess protection in challenge models

  • Correlative Protection Studies:

    • Determine if anti-VV2132 antibodies correlate with protection

    • Analyze neutralizing capacity against bacterial functions

    • Compare with protection conferred by other V. vulnificus antigens

This approach draws on successful immunological characterization of VvhA, where recombinant leukocidin domain immunization elicited protective responses with mixed Th1/Th2 immune activation . If VV2132 plays a role in pathogenesis or represents a conserved antigen, immunological methods may reveal its function and potential as a therapeutic target.

What comparative genomics approaches can elucidate the evolutionary significance of VV2132 across Vibrio species?

Comparative genomics provides powerful tools to understand the evolutionary context and potential functional significance of VV2132. The following methodological framework should be implemented:

Sequence-Based Analysis:

  • Ortholog Identification:

    • BLAST/HMMER searches across sequenced Vibrio genomes

    • Reciprocal best hit analysis to confirm orthology

    • Construction of comprehensive ortholog database

  • Phylogenetic Analysis:

    • Multiple sequence alignment of all identified orthologs

    • Maximum likelihood tree construction

    • Reconciliation with species phylogeny to identify gene duplication/loss events

  • Selection Analysis:

    • Calculate dN/dS ratios across aligned sequences

    • Identify sites under positive or purifying selection

    • Compare selection patterns with known functional domains

Genomic Context Analysis:

  • Synteny Mapping:

    • Examine conservation of genes flanking VV2132

    • Identify operonic structures and potential co-regulated genes

    • Compare genomic organization across Vibrio species

  • Mobile Element Association:

    • Screen for nearby insertion sequences, transposons, or phage elements

    • Assess potential for horizontal gene transfer

    • Examine GC content for evidence of foreign origin

  • Regulatory Element Analysis:

    • Identify conserved promoter elements

    • Map potential transcription factor binding sites

    • Compare with regulons of known virulence factors

Functional Association Mapping:

  • Co-expression Network Analysis:

    • Integrate available transcriptomic data across conditions

    • Identify genes with similar expression patterns

    • Construct co-expression networks to predict function

  • Protein Domain Architecture:

    • Compare domain organization with related proteins

    • Identify conserved functional motifs

    • Map evolutionary events affecting domain composition

  • Strain Phenotype Correlation:

    • Correlate sequence variants with recorded phenotypes

    • Assess association with virulence or environmental adaptation

    • Compare with patterns observed for known virulence factors like rtxA1

This comprehensive approach will reveal whether VV2132 follows evolutionary patterns similar to housekeeping genes (high conservation) or virulence factors (higher variability, evidence of horizontal transfer or recombination, as seen with rtxA1) . The findings will provide critical context for functional studies and potential role in Vibrio vulnificus biology.

What expression systems are optimal for producing structurally intact recombinant VV2132?

Selecting the optimal expression system for VV2132 is critical for obtaining properly folded, functional protein. The following methodological considerations should guide system selection and optimization:

Prokaryotic Expression Systems:

  • E. coli-Based Expression:

    • Strain Selection:

      • BL21(DE3): Standard strain shown effective for VV2132 expression

      • C41(DE3)/C43(DE3): Engineered for improved membrane protein expression

      • Lemo21(DE3): Allows tunable expression through rhamnose regulation

    • Vector Optimization:

      • pET series with T7 promoter for high-level expression

      • pBAD with arabinose-inducible promoter for titratable expression

      • Codon optimization for enhanced translation efficiency

    • Fusion Strategies:

      • N-terminal His-tag: Successfully implemented for VV2132

      • MBP fusion: Enhances solubility of membrane proteins

      • SUMO fusion: Improves folding and allows tag removal

  • Expression Condition Optimization:

    ParameterRange to TestMonitoring Method
    Induction OD₆₀₀0.4-1.0Growth curves
    Inducer Concentration0.01-1.0 mM IPTGSDS-PAGE
    Post-induction Temperature16-30°CWestern blot
    Expression Duration4-24 hoursFunctional assays
    Media CompositionLB, TB, auto-inductionYield quantification

Eukaryotic Expression Systems (for challenging cases):

  • Yeast Systems:

    • Pichia pastoris: Methylotrophic yeast with strong inducible promoters

    • Saccharomyces cerevisiae: Well-established genetics for membrane proteins

  • Insect Cell Systems:

    • Baculovirus expression vector system (BEVS)

    • Stable Drosophila S2 cell lines

  • Cell-Free Expression:

    • E. coli extract supplemented with detergents or lipids

    • Wheat germ extract for eukaryotic-like folding

For VV2132 specifically, E. coli expression systems have demonstrated success, with the protein successfully produced with an N-terminal His tag . Lower post-induction temperatures (16-25°C) and extended expression times often improve membrane protein folding and yield. Systematic optimization of expression conditions through Design of Experiments (DoE) approaches can further enhance product quality and quantity.

What analytical methods can resolve conflicting data in VV2132 functional characterization?

Resolving conflicting data in VV2132 functional characterization requires a systematic analytical approach that addresses potential sources of discrepancy. The following methodological framework helps reconcile contradictory findings:

Source Identification:

  • Technical Variation Analysis:

    • Perform interlaboratory validation studies

    • Standardize protocols with detailed SOPs

    • Implement blinded experimental designs and analyses

  • Biological Variation Assessment:

    • Evaluate strain-specific differences in VV2132 sequence and expression

    • Consider growth conditions affecting membrane composition

    • Assess potential post-translational modifications

  • Methodological Discrepancy Analysis:

    • Compare protein preparation techniques (tags, purification methods)

    • Analyze buffer compositions affecting protein stability

    • Evaluate assay-specific artifacts or limitations

Resolution Strategies:

  • Orthogonal Method Validation:

    • Apply multiple independent techniques to measure the same parameter

    • Compare results from different experimental approaches

    • Reconcile findings through cross-validation

  • Dose-Response and Kinetic Analysis:

    • Implement comprehensive concentration ranges

    • Perform time-course experiments to distinguish primary from secondary effects

    • Apply mathematical modeling to integrate temporal data

  • Context-Dependent Function Assessment:

    • Test function under varying environmental conditions

    • Evaluate potential cooperativity with other proteins

    • Consider membrane composition effects on protein behavior

Integrative Analysis Approaches:

  • Meta-Analysis:

    • Systematically combine data from multiple studies

    • Weight findings based on methodological robustness

    • Identify patterns across seemingly contradictory results

  • Computational Modeling:

    • Develop models accommodating apparently conflicting observations

    • Test predictions with targeted experiments

    • Refine models iteratively with new data

  • Conditional Functionality Framework:

    • Establish conditions under which each observed function occurs

    • Map functional transitions to environmental or cellular changes

    • Develop integrated model of context-dependent functionality

This comprehensive approach has successfully resolved conflicting data for other bacterial membrane proteins and can be effectively applied to VV2132 characterization. The resolution process may reveal multifunctional properties or context-dependent behaviors that explain apparent contradictions in experimental findings.

What purification strategies maximize yield and structural integrity of recombinant VV2132?

Purifying membrane proteins like VV2132 requires specialized approaches to maintain structural integrity while achieving high yields. The following methodological strategy is recommended:

Membrane Extraction Optimization:

  • Cell Lysis Optimization:

    • Mechanical disruption (e.g., French press) for efficient membrane release

    • Buffer optimization (pH 7.5-8.0, ionic strength 150-300 mM)

    • Protease inhibitor cocktail inclusion to prevent degradation

  • Detergent Selection:

    • Systematic screening of detergents (DDM, LMNG, CHAPS) for extraction efficiency

    • Optimization of detergent concentration (typically 1-2× CMC)

    • Evaluation of mixed detergent systems for enhanced stability

Chromatographic Purification:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Ni-NTA resin for His-tagged VV2132

    • Optimized imidazole gradient (20-300 mM) for specific elution

    • Addition of glycerol (10%) and reducing agent to maintain stability

  • Size Exclusion Chromatography (SEC):

    • Assessment of oligomeric state and homogeneity

    • Buffer optimization during SEC

    • Detection and elimination of aggregates

  • Quality Control Metrics:

    Assessment MethodParameter MeasuredAcceptance Criteria
    SDS-PAGEPurity>90% single band
    Western BlotIdentityPositive signal at expected MW
    SEC-MALSHomogeneity and sizeMonodisperse population
    Thermal Shift AssayStabilityDefined melting temperature

Alternative Approaches:

  • Native-Like Environment Reconstitution:

    • Transfer from detergent to nanodiscs or amphipols

    • Reconstitution into proteoliposomes for functional studies

    • SMALPs (Styrene Maleic Acid Lipid Particles) for detergent-free extraction

  • Scale-Up Considerations:

    • Implement tangential flow filtration for large-scale preparations

    • Optimize buffer recycling to reduce costs

    • Develop continuous processing workflows

Storage Optimization:

  • Maintain in Tris-based buffer with 50% glycerol at -20°C/-80°C

  • Aliquot to minimize freeze-thaw cycles

  • Consider lyophilization with cryoprotectants for long-term stability

For VV2132 specifically, current protocols have achieved >90% purity using His-tag affinity chromatography followed by size exclusion chromatography. The purified protein is typically maintained in a Tris-based buffer with glycerol for stability, allowing for successful application in downstream structural and functional studies .

How does VV2132 compare functionally with other membrane proteins in Vibrio vulnificus?

VV2132 belongs to the UPF0208 family of membrane proteins in Vibrio vulnificus, a classification that indicates its function remains uncharacterized. Comparing VV2132 with better-studied Vibrio vulnificus membrane proteins provides valuable context:

Comparative Membrane Protein Analysis:

ProteinFamily/TypeKnown FunctionsPathogenesis RoleStructural Features
VV2132UPF0208 membrane proteinUncharacterizedUnknown150 aa, predicted membrane association
MARTXRTX toxinPore formation, effector deliveryMajor virulence factorMulti-domain with effector regions
VvhAHemolysinPore formation, cytolysisVirulence factorLeukocidin domain, hemolytic activity

Structural Comparison:

  • VV2132 is significantly smaller (150 aa) than major virulence factors like MARTX toxins

  • Unlike MARTX toxins, which show genetic diversity with four distinct variants arising from genetic recombination , there is no current evidence for similar variation in VV2132

  • Lacks recognizable effector domains characteristic of toxins like VvhA or MARTX

Functional Implications:

  • The conserved nature of VV2132 across strains suggests a fundamental rather than pathogen-specific role

  • Membrane localization indicates potential roles in:

    • Transport of small molecules

    • Signal transduction

    • Membrane organization

    • Environmental sensing

Evolutionary Context:

  • While MARTX toxin variants show evidence of recombination with plasmid-carried genes or genes from other species , VV2132 appears more conserved

  • The smaller size and apparent conservation suggest VV2132 may be under different selective pressures than virulence factors

Understanding these comparative differences is essential for directing experimental approaches to elucidate VV2132 function. While major virulence factors like MARTX and VvhA contribute directly to cytotoxicity and host cell damage , the role of VV2132 may be more subtle, potentially involved in basic cellular processes or environmental adaptation rather than direct virulence mechanisms.

What bioinformatic approaches can predict potential functions of VV2132?

Predicting the function of uncharacterized proteins like VV2132 requires sophisticated bioinformatic approaches that integrate multiple layers of information. The following methodological framework provides a comprehensive prediction strategy:

Sequence-Based Prediction:

  • Homology Detection:

    • PSI-BLAST searches against non-redundant protein databases

    • Profile-HMM searches using HMMER against specialized databases

    • Remote homology detection using HHpred or PHYRE2

  • Motif and Domain Analysis:

    • Scan for conserved domains using InterProScan

    • Identify functional motifs using PROSITE or PRINTS

    • Analyze transmembrane topology using TMHMM, TOPCONS

  • Sequence Property Analysis:

    • Hydropathy profiling for membrane-spanning regions

    • Conservation analysis of surface-exposed residues

    • Disorder prediction to identify flexible regions

Structure-Based Prediction:

  • Structural Modeling:

    • Template-based modeling using I-TASSER or SWISS-MODEL

    • Ab initio modeling for regions lacking templates

    • Refinement using molecular dynamics simulations

  • Binding Site Prediction:

    • CASTp or POCASA for pocket detection

    • FTSite for ligand binding site prediction

    • Electrostatic surface analysis for interaction interfaces

  • Structural Comparisons:

    • DALI server for structural neighbors identification

    • TM-align for template-free structural comparisons

    • ProFunc for function prediction from structure

Network-Based Approaches:

  • Genomic Context Analysis:

    • Gene neighborhood conservation across Vibrio species

    • Co-occurrence patterns with functionally annotated genes

    • Operonic structure prediction

  • Protein-Protein Interaction Prediction:

    • STRING database analysis for interaction partners

    • Interolog mapping from model organisms

    • Domain-domain interaction predictions

  • Integration of -Omics Data:

    • Correlation analysis with transcriptomic datasets

    • Co-expression network construction

    • Integration with available proteomics data

By integrating these complementary approaches, researchers can develop testable hypotheses about VV2132 function. This methodology has successfully predicted functions for other uncharacterized bacterial membrane proteins and provides a systematic framework for characterizing VV2132's role in Vibrio vulnificus biology.

How can experimental design approaches from VvhA and MARTX toxin studies be adapted for VV2132 research?

Researchers investigating VV2132 can adapt successful experimental approaches used to characterize other Vibrio vulnificus proteins, particularly VvhA and MARTX toxins. The following methodological framework outlines strategies that can be transferred to VV2132 studies:

Genetic Analysis Approaches:

  • Targeted Mutagenesis:

    • Create clean deletion mutants of VV2132 using allelic exchange mutagenesis

    • Develop complementation strains expressing wild-type or mutated versions

    • Apply approaches used to demonstrate MARTX Vv toxin importance in virulence

  • Domain Mapping:

    • Generate constructs expressing predicted functional domains of VV2132

    • Assess domain-specific activities in isolation

    • Parallel successful approaches used for VvhA leukocidin domain characterization

  • Variant Analysis:

    • Screen diverse isolates for VV2132 sequence variations

    • Apply the phylogenetic approaches used to identify four distinct variants of rtxA1

    • Correlate variants with strain characteristics and ecological niches

Functional Characterization:

  • Cell-Based Assays:

    • Adapt cytotoxicity assays used for VvhA toxin

    • Assess effects on membrane integrity and cellular functions

    • Monitor potential immune stimulation patterns in parallel with VvhA studies

  • Host Response Analysis:

    • Investigate if VV2132 affects host inflammation pathways

    • Assess potential NLRP3 inflammasome activation as documented for VvhA

    • Examine calcium signaling responses similar to VvhA-induced pathways

  • In Vivo Models:

    • Utilize established mouse models of Vibrio vulnificus infection

    • Compare wild-type and VV2132 mutant strains using infection parameters

    • Apply quantitative infection strategies used for MARTX Vv toxin studies

Immunological Approaches:

  • Recombinant Protein Analysis:

    • Express and purify domains of VV2132 similar to VvhA leukocidin domain strategy

    • Assess immunological properties of the recombinant protein

    • Evaluate potential protective efficacy using protocols established for VvhA

  • Antibody Development:

    • Generate specific antibodies against VV2132 for detection and neutralization

    • Adapt neutralization assays from VvhA studies

    • Develop both polyclonal and monoclonal antibodies for different applications

By adapting these established methodologies that successfully characterized MARTX and VvhA toxins, researchers can systematically investigate VV2132's potential roles in bacterial physiology or pathogenesis. This approach builds on proven techniques while tailoring experiments to the specific characteristics of VV2132 as a membrane protein rather than a secreted toxin.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.