Recombinant Vibrio vulnificus UPF0761 membrane protein VV0203 (VV0203)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant VV0203

Recombinant Vibrio vulnificus UPF0761 membrane protein VV0203 is a full-length, His-tagged protein expressed in E. coli for research applications. It corresponds to the UniProt ID Q7MQ07 and spans 313 amino acids (1–313) with a molecular weight of approximately 35 kDa. This protein is lyophilized in a Tris/PBS-based buffer containing 6% trehalose, pH 8.0, and maintains >90% purity as confirmed by SDS-PAGE .

CharacteristicDetail
SourceVibrio vulnificus (bacterial pathogen)
Expression HostE. coli
TagN-terminal His tag
Protein LengthFull-length (1–313 aa)
Storage-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); 5–50% glycerol recommended

Primary Sequence Analysis

The amino acid sequence of VV0203 includes hydrophobic stretches indicative of transmembrane domains (TMDs), consistent with its classification as an alpha-helical membrane protein . Key motifs include:

  • Hydrophobic regions: Likely TMDs (e.g., residues 73–83, 85–93)

  • Charged residues: Positively charged amino acids (e.g., lysine, arginine) in loop regions, adhering to the "positive inside" rule for membrane topology

TMD CharacteristicsAlpha-Helical ProteinsBeta-Barrel Proteins
Avg. TMD Length26 ± 5 residues12 ± 3 residues
Total TMDs455334
FunctionTransport, signaling, enzymatic activityPore formation, transport

Source: MPtopo database

Biogenesis and Membrane Insertion

Membrane insertion of VV0203 likely follows the Sec-dependent pathway, given its alpha-helical structure. Key insights from related systems:

  • TMD hydrophobicity: Low hydrophobicity in TMD3 may trigger Sec-mediated insertion .

  • Charged residues: Positively charged loop regions (e.g., lysine at position 155) guide topology determination and prevent aggregation .

TranslocaseRole in VV0203 Biogenesis
SecYEGCo-translational insertion of TMDs with extended periplasmic loops
Oxa1/TatUnlikely, as Tat targets TMDs with twin-arginine motifs (absent in VV0203)

Experimental Uses

Recombinant VV0203 is utilized in:

  • Structural studies: X-ray crystallography or cryo-EM for TMD topology mapping

  • Functional assays: Cellular uptake, ligand binding, or enzymatic activity screens

  • Pathogenicity models: Studying Vibrio vulnificus membrane interactions in host cells

Critical Handling Guidelines

ParameterRecommendation
StorageAliquot immediately; store at -20°C/-80°C
ThawingBriefly centrifuge; reconstitute in sterile water
StabilityAvoid repeated freeze-thaw; add glycerol for prolonged storage

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VV0203; UPF0761 membrane protein VV0203
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Vibrio vulnificus (strain YJ016)
Target Names
VV0203
Target Protein Sequence
MNQLFGSDKLRLPQRAQAGIAFVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSI LSKFSVFENVGSVLQSFIINNFVPASGDAVHAALQEFIANTGKMTAVGAAFLFVAALMLI SNIDKNLNYIWRVKKKRRAVFSFSMYWMVLTLGPILVGASIAATSYITSLRLLDSEAIST VYDQLLRWLPFILSSSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAALGEREHWRPTEDVIQSLPNNDTEL EKDTQRDRFDSES
Uniprot No.

Target Background

Database Links

KEGG: vvy:VV0203

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant VV0203 protein?

Escherichia coli represents the primary expression system used for recombinant VV0203 protein production. When designing expression experiments, consider the following methodological approach:

  • Select an appropriate E. coli strain: BL21(DE3) is commonly used for membrane protein expression, though specialized strains may improve yields

  • Incorporate a purification tag: N-terminal His-tagging has been successfully applied for VV0203 protein production

  • Design expression vector with appropriate promoter strength: For membrane proteins prone to aggregation, moderate to weak promoters often yield better results than strong T7 promoters

  • Consider plasmid copy number: Low copy number plasmids (0-50 copies/cell) often produce better results for membrane proteins compared to high copy number plasmids (>100 copies/cell) which can lead to inclusion body formation

The recombinant protein has been successfully expressed in E. coli and purified to >90% purity as determined by SDS-PAGE analysis .

What are the optimal storage conditions for purified VV0203 protein?

For optimal stability and functionality of purified VV0203 protein, implement the following evidence-based storage protocol:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Long-term storage: Store at -20°C or -80°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • For extended preservation: Lyophilization is recommended

  • Upon reconstitution: Dissolve in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For freeze-thaw stability: Add glycerol to a final concentration of 50%

  • Avoid: Repeated freeze-thaw cycles which significantly reduce protein stability and functionality

These conditions maintain protein integrity by preventing degradation and preserving the native conformation of the membrane protein structure.

What strategies can overcome inclusion body formation when expressing recombinant VV0203?

Inclusion body formation represents a common challenge when expressing membrane proteins like VV0203. Implement the following methodological approaches to enhance soluble protein yield:

  • Optimize expression temperature: Lower temperatures (16-25°C) reduce protein synthesis rates and often improve folding

  • Modulate expression rate using specialized E. coli strains:

    • E. coli BL21(DE3):TN7 strain employs T7 phage RNA polymerase inhibitor (Gp2) to decouple recombinant protein expression from host cell growth, thereby reducing inclusion body formation

    • SoluB21™ strain has demonstrated success with difficult-to-express membrane proteins

  • Apply codon optimization for V. vulnificus genes expressed in E. coli

  • Co-expression strategies:

    • Express molecular chaperones alongside VV0203 to facilitate proper folding

    • Introduce periplasmic folding modulators for proteins requiring disulfide bond formation

  • Buffer optimization: Addition of mild detergents (0.1-1% n-dodecyl-β-D-maltoside or CHAPS) can solubilize membrane proteins during extraction

  • Fusion partner approach: Fusion with solubility-enhancing partners like MBP (maltose-binding protein) or SUMO can improve folding

These approaches systematically address the physicochemical challenges associated with membrane protein expression and can significantly increase the yield of properly folded VV0203.

How can researchers establish a rapid detection method for Vibrio vulnificus that might apply to studying VV0203 expression?

For researchers investigating VV0203 in the context of V. vulnificus detection, recombinase polymerase amplification (RPA) offers an efficient approach. The following methodology can be adapted for VV0203 detection:

  • Design primers targeting the VV0203 gene region with high specificity

  • Establish a real-time RPA protocol:

    • Reaction temperature: 39°C

    • Reaction time: 2-14 minutes

    • Template preparation: Crude lysates are tolerated

  • Technical performance characteristics:

    • Detection limit: ~17 gene copies per reaction

    • Sensitivity: 1 CFU per reaction

    • Specificity: High selectivity for V. vulnificus when properly designed

  • Validation against established methods:

    • Compare with qPCR to confirm detection efficiency

    • Validate with biochemical identification methods

This rapid detection approach not only facilitates identification of V. vulnificus but can be adapted to monitor VV0203 gene expression levels in recombinant systems, providing a valuable tool for optimization of production conditions .

What functional assays can be used to characterize the biological activity of purified VV0203 protein?

Characterizing the biological function of VV0203 requires specialized assays targeting membrane protein properties. Implement the following methodological approaches:

  • Membrane integration assessment:

    • Proteoliposome reconstitution followed by sucrose gradient ultracentrifugation

    • Fluorescence-based membrane insertion assays using labeled VV0203

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to determine secondary structure composition

    • Limited proteolysis combined with mass spectrometry to identify structurally protected domains

    • Blue native PAGE to assess oligomeric state in membrane environments

  • Interaction studies:

    • Pull-down assays using His-tagged VV0203 to identify binding partners

    • Surface plasmon resonance (SPR) to measure binding kinetics with potential ligands

    • Crosslinking studies to identify proximal proteins in native membranes

  • Physiological function investigation:

    • Growth complementation assays in V. vulnificus VV0203 knockout strains

    • Membrane permeability assays to assess potential transport functions

    • Analysis of phenotypic changes in VV0203 overexpression systems

These methods collectively provide a comprehensive functional profile of VV0203, elucidating its biological role in bacterial membrane processes.

What are the optimal purification strategies for obtaining high-quality VV0203 protein for structural studies?

Membrane protein purification presents unique challenges requiring specialized approaches. For VV0203, implement this systematic purification strategy:

  • Initial extraction from E. coli membranes:

    • Differential centrifugation to isolate membrane fractions (40,000-100,000 × g)

    • Solubilization screening with multiple detergents (DDM, LDAO, CHAPS)

    • Detergent concentration optimization (typically 1-2% for extraction, 0.1-0.5% for purification)

  • Multi-step chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Buffer composition: Tris-based buffer (pH 8.0) with appropriate detergent

    • Secondary purification: Size exclusion chromatography to remove aggregates

  • Protein quality assessment:

    • Purity verification by SDS-PAGE (target >95% for structural studies)

    • Dynamic light scattering to confirm monodispersity

    • Thermal stability assays to optimize buffer conditions

  • Crystallization preparation:

    • Buffer exchange to remove imidazole

    • Concentration optimization (typically 5-15 mg/mL for crystallization trials)

    • Consider lipid cubic phase methods for membrane protein crystallization

This methodical approach maximizes the likelihood of obtaining pure, homogeneous, and stable VV0203 protein suitable for high-resolution structural studies .

How should researchers design experiments to investigate VV0203 interaction with the bacterial membrane?

Investigating VV0203-membrane interactions requires specialized experimental approaches that preserve native membrane environment. Consider this methodological framework:

  • Fluorescent labeling strategies:

    • Site-specific labeling at non-conserved cysteine residues

    • FRET pair introduction to monitor conformational changes

    • Orientation determination using environment-sensitive fluorophores

  • Microscopy-based approaches:

    • Fluorescence microscopy to visualize localization in bacterial cells

    • TIRF microscopy for single-molecule studies of membrane dynamics

    • Super-resolution techniques (STORM, PALM) for nanoscale distribution analysis

  • Biophysical characterization:

    • Atomic force microscopy of VV0203 in supported lipid bilayers

    • Solid-state NMR to determine membrane topology

    • Neutron reflectometry to measure membrane insertion depth

  • Computational approaches:

    • Molecular dynamics simulations of VV0203 in lipid bilayers

    • Hydropathy plot analysis to predict transmembrane segments:

SegmentAmino Acid PositionPredicted Orientation
TM128-48Inside to outside
TM276-96Outside to inside
TM3120-140Inside to outside
TM4155-175Outside to inside
TM5195-215Inside to outside
TM6230-250Outside to inside

This integrated experimental approach provides complementary data on VV0203 membrane orientation, dynamics, and structural features in the native-like environment.

What controls should be included when studying the impact of VV0203 overexpression on bacterial physiology?

Rigorous experimental design with appropriate controls is essential for meaningful interpretation of VV0203 overexpression studies:

  • Expression control comparison set:

    • Empty vector control: Same plasmid backbone without VV0203 gene

    • Inactive mutant control: VV0203 with site-directed mutations in predicted functional residues

    • Alternative membrane protein control: Different membrane protein of similar size/topology

    • Inducible expression system: To compare pre- and post-induction physiology in the same cells

  • Physiological parameter measurements:

    • Growth curves under various conditions (temperature, osmolarity, pH)

    • Membrane integrity assays (permeability, potential, fluidity)

    • Cellular stress response indicators (chaperone levels, stress-responsive genes)

    • Metabolomic profiling to identify altered pathways

  • Statistical considerations:

    • Minimum of three biological replicates for each condition

    • Appropriate statistical tests based on data distribution

    • Power analysis to determine sample size requirements

    • Multiple testing correction for omics-level analyses

  • Temporal dynamics evaluation:

    • Time-course studies to distinguish primary from secondary effects

    • Pulse-chase experiments to determine protein turnover rates

    • Inducible promoters with varying strengths to create expression gradients

This comprehensive control framework isolates VV0203-specific effects from general consequences of recombinant protein expression and provides robust data for interpretation of the protein's physiological role .

What are the most common technical challenges in VV0203 purification and how can they be addressed?

Membrane protein purification frequently encounters technical obstacles. For VV0203, implement these evidence-based troubleshooting approaches:

  • Low expression yield:

    • Optimize codon usage for E. coli expression

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Evaluate lower induction temperatures (16-25°C) and extended expression times

    • Consider auto-induction media for gradual protein production

  • Protein aggregation:

    • Screen multiple detergents at various concentrations

    • Include stabilizing agents (glycerol, specific lipids, osmolytes)

    • Evaluate different buffer systems (HEPES, MES, phosphate) and pH conditions

    • Consider fusion with solubility-enhancing partners

  • Poor affinity chromatography binding:

    • Verify tag accessibility through Western blotting

    • Optimize imidazole concentration in binding and washing steps

    • Evaluate alternative tag positions (N- versus C-terminal)

    • Consider tandem affinity purification approach

  • Protein instability:

    • Implement thermal shift assays to identify stabilizing conditions

    • Screen additives (salts, amino acids, polyols) for stability enhancement

    • Consider purification at reduced temperatures (4°C)

    • Test amphipols or nanodiscs for detergent-free stability

These systematic approaches address the specific challenges associated with membrane protein biochemistry and can significantly improve VV0203 purification outcomes .

How can researchers troubleshoot issues with recombinant VV0203 folding and stability?

Proper folding and stability are critical challenges for membrane proteins like VV0203. Apply this methodological framework to address folding issues:

  • Expression optimization:

    • Reduce expression rate using weak promoters or low copy number plasmids

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Test specialized E. coli strains designed for membrane proteins

    • Implement pulse-chase expression with defined recovery periods

  • Folding assessment methods:

    • Limited proteolysis to compare digestion patterns with native protein

    • Intrinsic tryptophan fluorescence to monitor tertiary structure

    • Size-exclusion chromatography profiles to detect aggregation

    • Thermal denaturation curves to measure stability

  • Stabilization strategies:

    • Screen ligands or substrates that may stabilize native conformation

    • Test lipid supplementation during expression and purification

    • Identify optimal detergent:protein:lipid ratios

    • Consider protein engineering approaches targeting unstable regions

  • Refolding approaches (if inclusion bodies form):

    • Develop on-column refolding protocols with decreasing denaturant gradients

    • Screen mild solubilization conditions using various detergents

    • Test cyclodextrin-assisted folding methods

    • Evaluate artificial chaperone-assisted refolding

This systematic approach addresses the folding challenges specific to membrane proteins and provides multiple intervention points to improve VV0203 structural integrity .

What emerging technologies are advancing the study of membrane proteins like VV0203?

Recent technological developments are transforming membrane protein research with several approaches particularly relevant to VV0203 studies:

  • Advanced structural biology methods:

    • Cryo-electron microscopy for high-resolution structures without crystallization

    • Micro-electron diffraction (MicroED) for structural analysis from nanocrystals

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Integrative structural biology combining multiple experimental data sources

  • Novel expression systems:

    • Cell-free expression systems with defined membrane mimetics

    • Synthetic minimal cells for membrane protein production

    • Engineered E. coli strains with enhanced membrane protein folding capacity

    • Nanobody-based crystallization chaperones to facilitate structural studies

  • Computational approaches:

    • Deep learning prediction of membrane protein structures

    • Molecular dynamics simulations with enhanced sampling techniques

    • Systems biology modeling of membrane protein networks

    • Quantum mechanics/molecular mechanics methods for functional mechanisms

  • Single-molecule techniques:

    • High-speed atomic force microscopy for conformational dynamics

    • Single-molecule FRET to track protein movements in membranes

    • Optical tweezers to measure mechanical properties and energy landscapes

    • Nanopore-based electrical recordings for transport properties

These emerging technologies provide powerful new tools to elucidate the structure, function, and dynamics of membrane proteins like VV0203, opening new research avenues and addressing previously intractable questions .

What are the potential applications of understanding VV0203 function in Vibrio vulnificus pathogenesis research?

Understanding VV0203 may provide valuable insights into V. vulnificus pathogenesis with several translational implications:

  • Diagnostic applications:

    • Development of specific detection methods targeting VV0203

    • Implementation of real-time RPA approaches for rapid detection in clinical or environmental samples

    • Creation of antibody-based detection systems for protein expression analysis

  • Pathogenesis mechanisms:

    • Determination of VV0203 role in bacterial survival within host environments

    • Analysis of membrane protein contributions to antibiotic resistance

    • Investigation of potential involvement in virulence factor secretion or regulation

  • Therapeutic target evaluation:

    • Assessment of VV0203 as a potential antimicrobial target

    • Structure-based drug design targeting essential membrane functions

    • Evaluation of membrane protein inhibitors for pathogen-specific activity

  • Environmental monitoring applications:

    • Development of biosensors incorporating VV0203-detection elements

    • Implementation in water quality testing protocols

    • Integration with existing V. vulnificus detection methods for improved sensitivity

These applications highlight the potential translational impact of basic research on bacterial membrane proteins like VV0203, connecting fundamental science to practical applications in infectious disease management and public health .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.