Recombinant Vicia faba Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vicia faba Apocytochrome f (petA)

Recombinant Vicia faba Apocytochrome f (petA) refers to a form of cytochrome f, a protein crucial in photosynthetic electron transport chains in plants, that is produced using recombinant DNA technology in Vicia faba, commonly known as broad bean . Cytochrome f is a major protein of the thylakoid membrane, anchored by a single transmembrane α-helix near the C terminus, and is highly conserved among higher plants . The large globular N terminus (residues 1–250) protrudes into the thylakoid lumen, while the 15-amino acid C terminus (residues 271–285) extends into the stroma .

Production and Expression

A fragment of the petA gene from broad bean (Vicia faba) that corresponds to the globular N-terminal domain of the mature protein can be expressed in E. coli . To achieve this, a 741-bp fragment of the cytochrome f gene (petA) is amplified via PCR using specific primers. These primers incorporate NcoI and HindIII restriction site extensions at the upstream and downstream ends, respectively . The upstream primer includes an ATG start codon, which is necessary because the 5′ end of the truncated gene corresponds to the N terminus of the mature protein. This mature protein is formed by cleaving the 35-amino acid thylakoid targeting sequence of apocytochrome f . The amplified PCR product is then digested with NcoI/HindIII and cloned into the expression vector, pTrc99A, creating pTrc99A-petA1 . E. coli DH5-α cells transformed with pTrc99A-petA1 are grown to an optical density of 0.6 at 600 nm, and expression of the truncated petA gene is induced by treatment with 1 mM isopropyl-1-thio-β-d-galactopyranoside for 3 hours at 30°C . Finally, cell lysate containing the cytochrome f recombinant protein is isolated .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Vicia faba (Broad bean) (Faba vulgaris)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAILPDTVFEAVVRIPYDMQVKQV LANGKKGALNVGAVLILPEGFELAPPDRLSPEIKEKIGNLSFQSYRPTKKNIIVIGPVPG KKYSEITFPILSPDPATKRDVYFLKYPIYVGGTRGRGQIYPDGSKSNNNVYNATATGVVN KKIRKEKGGYEITIVDGSDGREVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLLFLASIILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Vicia faba Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in photosynthesis?

Apocytochrome f, encoded by the petA gene, is a crucial component of the cytochrome b6f complex located in the thylakoid membrane of chloroplasts. This complex serves as an electronic connection between Photosystem I (PSI) and Photosystem II (PSII) in the electron transport chain of oxygenic photosynthesis. The cytochrome b6f complex is essential for energy transfer during photosynthesis, functioning as a plastoquinol-plastocyanin oxidoreductase .

The mature cytochrome f protein is formed when the apocytochrome f (the protein without its heme group) acquires its heme prosthetic group. This transformation is critical for the protein's electron transfer capability and proper function within the photosynthetic apparatus.

How is the petA gene organized in the chloroplast genome of Vicia faba?

The petA gene in Vicia faba is located in the chloroplast genome. Research has shown that in pea plants (closely related to Vicia faba), a 1 kbp region upstream from the petA gene contains an open reading frame of 231 codons (ORF231) that encodes a putative membrane-spanning polypeptide. This ORF is separated by 205 bp from the coding region of petA and is homologous to open reading frames located in a similar position with respect to petA in chloroplast DNA from various species including Marchantia polymorpha, tobacco, rice, wheat, and critically, Vicia faba .

Northern hybridization analysis indicates the presence of a complex pattern of transcripts containing both ORF231 and petA in chloroplasts. Large transcripts of 5.5 kb, 4.3 kb, 3.4 kb, and 2.7 kb encode both ORF231 and apocytochrome f, demonstrating that ORF231 and petA are co-transcribed .

What expression systems are suitable for producing recombinant Apocytochrome f?

Several expression systems can be employed for the production of recombinant Vicia faba Apocytochrome f, with varying advantages depending on research needs:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yields, short turnaround time, cost-effectiveLimited post-translational modifications, potential for inclusion bodiesHighest yield, suitable for structural studies
YeastGood yields, some post-translational modificationsLonger production time than E. coliHigh yield, suitable for functional studies
Insect cells (baculovirus)Better post-translational modificationsMore complex system, longer production timeModerate yield
Mammalian cellsClosest to native post-translational modificationsMost complex, longest production time, expensiveLower yield

E. coli and yeast systems generally offer the best yields and shorter turnaround times for recombinant Apocytochrome f production. For studies requiring proper protein folding or retention of specific activities, insect cells with baculovirus or mammalian cells can provide many of the post-translational modifications necessary .

How should researchers optimize storage conditions for recombinant Apocytochrome f?

For optimal preservation of recombinant Apocytochrome f activity, follow these research-validated storage protocols:

  • Long-term storage: Store at -20°C/-80°C upon receipt, with proper aliquoting to avoid repeated freeze-thaw cycles.

  • Working solutions: Store working aliquots at 4°C for up to one week.

  • Buffer composition: Optimal storage buffer typically consists of Tris/PBS-based buffer with 50% glycerol for liquid formulations.

  • Lyophilized storage: For lyophilized preparations, use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 before lyophilization.

  • Reconstitution procedure: Briefly centrifuge the vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding 5-50% of glycerol (final concentration) and aliquoting for long-term storage .

How is the petA gene transcribed and regulated in chloroplasts?

The petA gene in Vicia faba and related species shows a complex transcriptional pattern. Research indicates that:

  • The petA gene is co-transcribed with an upstream open reading frame (ORF231) that encodes a putative membrane-spanning polypeptide that may be a haem-binding protein, possibly a b-type cytochrome .

  • Northern hybridization analysis reveals multiple transcript sizes (5.5 kb, 4.3 kb, 3.4 kb, and 2.7 kb) containing both ORF231 and apocytochrome f, indicating complex post-transcriptional processing .

  • Transcriptional regulation of petA varies among different plant species, with differential expression levels observed when compared to other chloroplast genes such as rbcL. For instance, promoter activity studies in E. coli have shown that the petA promoter produces relatively low levels of activity compared to the rbcL promoter, which encodes the large subunit of RuBisCO .

  • The promoter regions of chloroplast genes, including petA, can be identified and characterized using reporter gene systems in E. coli, demonstrating the conserved nature of basic transcriptional machinery between bacteria and chloroplasts .

What are the key structural features of Apocytochrome f that affect its function?

Apocytochrome f has several structural features crucial for its function in the electron transport chain:

  • Heme-binding domain: The protein contains conserved histidine residues that serve as ligands for the heme group, critical for electron transfer capabilities.

  • Membrane-spanning region: A hydrophobic domain anchors the protein in the thylakoid membrane, with the catalytic domain extending into the lumen.

  • Conserved sequences: Certain sequences show high conservation across species, particularly around the heme-binding site, indicating their functional importance in electron transfer.

  • N-terminal processing: The mature protein requires proper N-terminal processing of the precursor protein for correct localization and function.

  • Interaction domains: Specific regions facilitate interactions with other components of the cytochrome b6f complex, particularly cytochrome b6, subunit IV (PetD), and the Rieske iron-sulfur protein .

How conserved is the petA gene across different plant species?

The petA gene shows remarkable conservation across plant species, reflecting its essential role in photosynthesis. Comparative genomic analyses reveal:

  • The open reading frame (ORF) structure of petA is highly conserved across diverse plant species, including Marchantia polymorpha (liverwort), tobacco, rice, wheat, and Vicia faba, despite their evolutionary distance .

  • The sequence around conserved histidine residues in the membrane-spanning region resembles sequences present in cytochrome b from chromaffin granules and neutrophil membranes, suggesting functional conservation beyond plants .

  • The genomic context is also conserved, with the upstream ORF231 and its relationship to petA maintained across multiple species, indicating selective pressure to preserve this arrangement .

  • Despite the high conservation of coding sequences, chloroplast genomes show structural variation among species. For example, while most plants and green algae have similar chloroplast chromosome structures, some legumes including Pisum sativum and Vicia faba show structural variations .

What insights have genomic studies of Vicia faba provided about its evolution and domestication?

Genomic studies on Vicia faba have revealed important evolutionary and domestication insights:

  • Vicia faba is thought to have been domesticated in the Eastern Mediterranean region, possibly between Afghanistan and the Eastern Mediterranean, although no extant wild relative has yet been found .

  • Faba bean possesses one of the largest and least studied genomes among cultivated crop plants. Recent advancements in genomic resources have significantly improved understanding of its genetic structure .

  • Comparative genetic mapping between faba bean and Medicago truncatula has revealed macro-syntenic relationships, providing insights into chromosome evolution in legumes. Despite the large size of the faba bean genome, comparative mapping did not reveal evidence for polyploidization, segmental duplication, or significant rearrangements compared to M. truncatula .

  • Non-coding repetitive DNA or transposable element content, rather than genome duplication, likely explains the difference in genome sizes between faba bean and related species .

  • The patterns of genome rearrangements observed in faba bean and lentil compared to M. truncatula support phylogenetic studies dividing these species into the tribes Viceae and Trifoliae .

How is recombinant Apocytochrome f used to study thylakoid membrane protein insertion mechanisms?

Recombinant Apocytochrome f serves as an excellent model for studying protein insertion mechanisms into the thylakoid membrane. Recent research has revealed:

  • Unlike some thylakoid proteins, native PetD (a subunit of the same cytochrome b6f complex as Apocytochrome f) cannot incorporate into thylakoid membranes spontaneously but requires the post-translational signal recognition particle (SRP) pathway .

  • The insertion process involves the coordinated action of cpFTSY, cpSRP54, and ALB3 insertase, forming a cpSRP-cpFtsY-ALB3-PetD complex .

  • These findings with PetD provide a model for studying other thylakoid membrane proteins, including Apocytochrome f, revealing how different components of the same protein complex may utilize different insertion pathways.

  • Recombinant Apocytochrome f can be used to investigate whether it follows similar insertion mechanisms or employs alternative pathways, contributing to a comprehensive understanding of how the cytochrome b6f complex is assembled in the thylakoid membrane .

What approaches are effective for studying interactions between Apocytochrome f and other components of the cytochrome b6f complex?

Several methodological approaches have proven effective for studying the interactions between Apocytochrome f and other components of the cytochrome b6f complex:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentifying protein-protein interactions in near-native conditionsPreserves physiological interactionsRequires specific antibodies
Surface plasmon resonanceMeasuring binding kinetics and affinitiesReal-time, label-free detectionRequires purified proteins
Crosslinking studiesCapturing transient interactionsCan detect weak or transient interactionsMay introduce artifacts
Fluorescence resonance energy transfer (FRET)Visualizing interactions in vivoCan be used in living cellsRequires fluorescent tags
Yeast two-hybridScreening for potential interactorsHigh-throughput possibilityHigh false positive rate
Recombinant expression of complex componentsReconstitution of complexes in vitroControl over conditionsMay not fully recapitulate in vivo assembly

These techniques are complementary and often used in combination to validate findings and obtain a comprehensive understanding of protein interactions within the cytochrome b6f complex.

How do transcriptomic studies enhance our understanding of petA gene expression during plant stress responses?

Transcriptomic studies have provided valuable insights into how petA gene expression changes during various stress conditions:

  • RNA sequencing technologies enable global gene expression profiling during plant responses to parasitic plants, such as the case study of Vicia faba response to Orobanche foetida infestation .

  • Such studies have revealed differential expression of pathways associated with secondary metabolites: flavonoids, auxin, thiamine, and jasmonic acid in response to parasitic plant attack .

  • Specific transcription factors, such as WRKY genes, play important roles in coordinating these responses, affecting the expression of photosynthetic genes including petA .

  • By comparing susceptible and resistant varieties, researchers can identify key differences in gene expression patterns, including those of chloroplast genes like petA, that may contribute to stress tolerance or susceptibility .

  • These findings help develop targeted breeding strategies for improving stress resistance in faba bean while maintaining optimal photosynthetic performance .

What are the primary challenges in expressing and purifying recombinant membrane proteins like Apocytochrome f?

Expressing and purifying membrane proteins such as Apocytochrome f presents several challenges:

  • Protein solubility: The hydrophobic transmembrane domains often lead to protein aggregation and inclusion body formation, particularly in E. coli expression systems.

  • Proper folding: Membrane proteins require specific lipid environments for correct folding, which may be absent in heterologous expression systems.

  • Post-translational modifications: Some modifications crucial for function may not occur properly in simplified expression systems.

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membranes, leading to toxicity and reduced yields.

  • Purification difficulties: Extracting membrane proteins while maintaining their native structure requires careful selection of detergents and buffer conditions.

Researchers can address these challenges through several strategies:

  • Using specialized E. coli strains designed for membrane protein expression

  • Adding fusion tags that enhance solubility

  • Optimizing growth temperatures (often lower temperatures improve folding)

  • Including specific lipids or detergents in the growth medium

  • Employing gentle extraction methods using mild detergents

How can researchers verify the integrity and functionality of purified recombinant Apocytochrome f?

Several analytical techniques can be employed to verify the integrity and functionality of purified recombinant Apocytochrome f:

  • SDS-PAGE analysis: Confirms protein purity and expected molecular weight (approximately 22-31 kDa depending on tags and processing) .

  • Western blotting: Verifies protein identity using specific antibodies.

  • UV-visible spectroscopy: Characteristic absorption spectra of the heme group (if properly incorporated) can confirm functionality.

  • Circular dichroism (CD) spectroscopy: Assesses protein secondary structure to confirm proper folding.

  • Electron paramagnetic resonance (EPR): Evaluates the electronic state of the heme iron.

  • Functional assays: Measuring electron transfer capabilities using artificial electron donors and acceptors.

  • Mass spectrometry: Confirms protein identity and can detect post-translational modifications.

  • Reconstitution experiments: Testing whether the purified protein can integrate into liposomes or native thylakoid membranes and participate in electron transport.

What alternative approaches exist for studying Apocytochrome f when animal-derived antibodies present limitations?

Traditional research often relies on animal-derived antibodies, which can present reproducibility issues. Several animal-free alternatives are available for studying Apocytochrome f:

  • Recombinant antibodies (rAbs): These sequence-defined antibodies offer numerous advantages over animal-derived antibodies, including higher affinity and specificity, faster generation time, reduced immunogenicity, and the ability to control selection conditions .

  • Aptamers: Single-stranded DNA or RNA molecules that can bind specifically to target proteins.

  • Nanobodies: Single-domain antibody fragments derived from camelid antibodies, which can be produced recombinantly.

  • Affimers/Affibodies: Small non-antibody binding proteins engineered to bind specific targets.

  • CRISPR-based tagging: Directly tagging the endogenous protein in vivo for visualization or pull-down experiments.

These animal-free alternatives address the reproducibility crisis associated with traditional antibodies. A systematic analysis found that one-third of commercially available hybridoma monoclonal antibodies were not reliably monospecific, and only 0.5% to 5% of antibodies in polyclonal reagents bind to their intended targets . In 2020, the European Union Reference Laboratory for alternatives to animal testing recommended that more reproducible recombinant reagents should replace animal-derived antibodies .

What emerging technologies might advance our understanding of Apocytochrome f structure and function?

Several cutting-edge technologies show promise for advancing our understanding of Apocytochrome f:

  • Cryo-electron microscopy: Allows visualization of membrane protein structures without crystallization, potentially revealing dynamic states of the cytochrome b6f complex.

  • Single-molecule techniques: Can track individual protein molecules and their interactions, providing insights into the dynamics of electron transfer.

  • Advanced mass spectrometry: Techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can probe protein dynamics and interaction surfaces.

  • Artificial intelligence approaches: Machine learning algorithms can predict protein-protein interactions and functional effects of mutations in the petA gene.

  • Genome editing technologies: CRISPR-Cas9 and base editing allow precise modification of the petA gene in vivo to study structure-function relationships.

  • Synthetic biology approaches: Rebuilding simplified versions of the cytochrome b6f complex with defined components to understand the minimal requirements for function.

  • High-resolution imaging techniques: Super-resolution microscopy can visualize the organization and dynamics of photosynthetic complexes in thylakoid membranes.

How might comparative genomic approaches deepen our understanding of petA evolution and adaptation?

Comparative genomic approaches offer significant potential for understanding petA evolution:

  • Expanded genomic sampling: As more plant genomes are sequenced, broader comparative analyses can reveal patterns of selection and adaptation in the petA gene across diverse lineages.

  • Analysis of natural variation: Studying petA sequence variation within species can identify adaptive changes related to environmental conditions.

  • Ancestral sequence reconstruction: Computational methods can infer ancestral petA sequences, which can be synthesized and characterized to understand evolutionary trajectories.

  • Correlation with ecological data: Linking petA sequence variations to ecological niches can reveal adaptive significance of specific mutations.

  • Evolutionary rate analysis: Comparing the rates of synonymous and non-synonymous substitutions can identify regions under positive or purifying selection.

  • Horizontal gene transfer detection: Investigating potential instances of horizontal gene transfer involving petA or related genes.

  • Integration with structural data: Mapping evolutionary changes onto protein structures to understand their functional implications.

These approaches can help explain how this essential photosynthetic gene has evolved while maintaining its critical function across diverse plant lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.