Recombinant Vicia faba Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please specify them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preference for a particular tag type, please inform us and we will prioritize developing it.
Synonyms
COX3; COXIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Vicia faba (Broad bean) (Faba vulgaris)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFILYTMFVW WRDVLRESTLEGHHTKVVQLGPRYGSISFIVSEVMFLFAFFRASSHSSLAPTVEIGGIWP PKGIGVLDPREIPFLNTPILLSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVFTGFQ GMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGQMTKEHHVGFEA AAWYWHFVDVVRLFPFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 3 (COX3) and what is its role in Vicia faba metabolism?

Cytochrome c oxidase subunit 3 (COX3) is an essential component of the mitochondrial respiratory chain in Vicia faba. As part of the cytochrome c oxidase complex (Complex IV), it plays a crucial role in cellular respiration by facilitating electron transfer to molecular oxygen, the final electron acceptor. The COX3 gene in Vicia faba is encoded by the mitochondrial genome and shows significant arrangement differences between various lines and cultivars. The genomic regions around COX3 exhibit notable heterogeneity, reflecting the complex nature of plant mitochondrial genomes and their evolution . This variation has important implications for mitochondrial function and potentially for plant adaptive responses to environmental conditions.

How does mitochondrial genome heterogeneity affect COX3 gene structure in Vicia faba?

The mitochondrial genome of Vicia faba exhibits significant intraspecific heterogeneity, which directly affects the structure and organization of respiratory genes including COX3. Research has revealed notable differences in the arrangement of genomic regions surrounding the COX3 gene across different faba bean lines. This heterogeneity is part of a broader pattern of variation that also affects other mitochondrial genes including coxII, cob, rrn26, and atpA . The presence of recombinationally active repeats associated with these genes drives genomic rearrangements, contributing to the observed heterogeneity. Restriction mapping of these regions has revealed distinct recombinative variants, demonstrating that COX3 exists within a dynamic genomic context that may influence its expression and function across different Vicia faba varieties and under varied environmental conditions.

What techniques are most effective for isolating the COX3 gene from Vicia faba?

For effective isolation of the COX3 gene from Vicia faba, a multi-step approach is recommended. Begin with high-quality mitochondrial DNA extraction using a GUTC (Guanidinium-Tris-CDTA buffer with celite) method, which has proven effective for plant mitochondrial DNA isolation . PCR amplification should utilize specific primers designed to target conserved regions flanking the COX3 gene. For initial characterization, Restriction Fragment Length Polymorphism (RFLP) analysis using enzymes such as HinfI, TaqI, MspI, and HaeIII can effectively distinguish variants . For more detailed analysis, clone and sequence the amplified products. When analyzing sequence data, comparative approaches similar to those employed in COX3 studies of other organisms can be applied, where sequence variations ranging from 0-32.4% have been observed between species . These methods enable both isolation and characterization of COX3 variants, providing insight into mitochondrial genome diversity in Vicia faba.

How can recombinant Vicia faba COX3 be effectively expressed in heterologous systems?

Expression of recombinant Vicia faba COX3 in heterologous systems presents several challenges due to its mitochondrial origin and hydrophobic nature. For successful expression, consider three primary approaches: 1) Bacterial expression systems (E. coli) utilizing specialized vectors containing solubility-enhancing tags (MBP or SUMO) and optimized for membrane proteins; 2) Yeast expression systems (S. cerevisiae or P. pastoris) that provide a eukaryotic environment with appropriate post-translational modification machinery; or 3) Plant-based expression systems that most closely mimic the native environment. For bacterial systems, codon optimization is crucial to account for differences between plant mitochondrial and bacterial codon usage. Expression should be conducted at lower temperatures (16-20°C) to prevent inclusion body formation. Purification strategies should incorporate mild detergents (DDM or CHAPS) to maintain protein structure. Western blotting using antibodies against conserved COX3 epitopes can confirm successful expression, while activity assays measuring electron transfer can verify functional integrity of the recombinant protein.

How do structural variations in COX3 correlate with functional differences in mitochondrial respiration?

Structural variations in Vicia faba COX3 significantly impact mitochondrial respiratory efficiency through alterations in proton pumping, complex assembly, and electron transfer kinetics. Amino acid substitutions in transmembrane regions can modify proton translocation pathways, directly affecting the proton gradient essential for ATP synthesis. Mutations in conserved regions, particularly at sites interacting with other complex subunits, may compromise complex stability and assembly efficiency. The relationship between COX3 sequence variation and function can be investigated through comparative analysis with COX3 variants from other species, where sequence variations between 0-32.4% have been documented . These variations likely alter electron transfer rates and efficiency. When analyzing COX3 variants in Vicia faba, researchers should consider both direct effects on protein function and broader impacts on respiratory complex assembly and stability. Detailed structure-function analyses using site-directed mutagenesis of recombinant COX3, followed by respiratory measurements, can elucidate the functional significance of naturally occurring variations.

What PCR and sequencing strategies are most effective for amplifying and characterizing the COX3 gene?

For optimal amplification and characterization of the COX3 gene from Vicia faba, a comprehensive PCR and sequencing approach is recommended. Design primers targeting conserved regions flanking the COX3 gene, similar to approaches used for other species where a 552-bp region was successfully amplified . Initial PCR conditions should include a touchdown protocol to enhance specificity, with annealing temperatures starting at 58°C and decreasing to 54°C. For difficult templates, addition of 5% DMSO or betaine may improve amplification of GC-rich regions. Following amplification, conduct RFLP analysis with restriction enzymes HinfI, TaqI, MspI, and HaeIII to identify potential variants before sequencing . For sequencing, both standard Sanger methodology and next-generation approaches should be considered depending on project scope. For Sanger sequencing, clone PCR products into appropriate vectors to ensure clean sequencing reads. When analyzing sequence data, utilize both nucleotide and predicted amino acid sequences to identify functional domains and potential variants. Compare obtained sequences with databases using BLAST and conduct phylogenetic analysis using maximum likelihood or Bayesian methods to establish evolutionary relationships with COX3 from other plant species.

How can researchers effectively analyze COX3 gene expression patterns in different tissues and under varied conditions?

To comprehensively analyze COX3 gene expression patterns in Vicia faba, researchers should implement a multi-method approach combining quantitative real-time PCR (qRT-PCR), RNA-seq, and protein-level detection. For qRT-PCR, design primers specific to COX3 with amplicon sizes of 80-150 bp, and normalize expression using multiple reference genes such as GAPDH, Actin, and EF1α to ensure reliable quantification. When measuring COX3 expression under stress conditions, collect samples at multiple time points (e.g., 0, 6, 12, 24, 48, and 72 hours post-treatment) to capture the temporal dynamics of expression changes. This approach is particularly important when studying responses to viral infections like BYMV, where plants show progressive symptom development . For tissue-specific expression, perform laser capture microdissection before RNA extraction to isolate specific cell types. At the protein level, western blotting with COX3-specific antibodies provides confirmation of transcriptional findings, while blue native PAGE can assess incorporation of COX3 into the complete cytochrome c oxidase complex. For comprehensive expression profiling, RNA-seq analysis offers the advantage of simultaneously measuring all mitochondrial genes, providing context for COX3 expression patterns relative to other components of the respiratory chain.

What are the best methods for purifying recombinant Vicia faba COX3 while maintaining its native conformation?

Purification of recombinant Vicia faba COX3 with preserved native conformation requires a carefully designed protocol that accounts for its hydrophobic nature and complex structure. Begin with expression in a system that allows proper membrane insertion, such as P. pastoris or insect cells, rather than bacterial systems that often produce inclusion bodies. For extraction, use a gentle solubilization approach with non-ionic detergents like DDM (n-dodecyl β-D-maltoside) at 1-2% concentration, gradually reducing to 0.05% in later purification steps to maintain the lipid environment essential for proper folding. A two-step chromatography approach is recommended: initial purification via immobilized metal affinity chromatography (IMAC) using a histidine tag, followed by size exclusion chromatography to separate monomeric COX3 from aggregates. Throughout purification, maintain physiological pH (7.2-7.4) and include glycerol (10-15%) to stabilize the protein. To verify structural integrity, combine circular dichroism spectroscopy to assess secondary structure elements with limited proteolysis to confirm proper folding. Functional assessment should include heme binding assays and electron transfer activity measurements. Store the purified protein in small aliquots at -80°C in buffer containing 10% glycerol and 0.02% DDM to prevent freeze-thaw damage and maintain stability.

How can researchers interpret sequence variations in the COX3 gene in relation to evolutionary history and adaptation?

Interpreting sequence variations in Vicia faba COX3 requires a multi-faceted analytical approach to determine evolutionary significance and potential adaptive functions. Begin with multiple sequence alignment of COX3 sequences from diverse Vicia faba accessions, comparing them to related legume species to identify conserved and variable regions. Calculate nucleotide diversity (π) and haplotype diversity (Hd) indices to quantify variation levels. Apply selective pressure analyses using dN/dS ratios to identify sites under positive, neutral, or purifying selection. A ratio significantly greater than 1 in specific regions suggests positive selection potentially related to environmental adaptation. Construct phylogenetic trees using maximum likelihood or Bayesian inference methods to establish evolutionary relationships, similar to approaches used in other COX3 studies where multiple genes improved phylogenetic resolution . Examine associations between specific COX3 variants and geographic or environmental factors to identify potential adaptive signatures. Incorporate population genetic analyses such as Tajima's D or Fu's Fs to detect demographic events or selection. Compare these patterns with those observed in other mitochondrial genes to distinguish COX3-specific selection from broader mitochondrial genomic patterns. Finally, map significant variations onto predicted protein structures to assess potential functional implications of adaptive changes.

What approaches should researchers take when encountering contradictory results in COX3 functional studies?

When confronted with contradictory results in Vicia faba COX3 functional studies, researchers should implement a systematic troubleshooting and reconciliation approach. First, critically evaluate methodological differences between studies, including plant growth conditions, tissue sampling protocols, extraction methods, and analytical techniques, as these factors can significantly influence outcomes. The heterogeneity of the Vicia faba mitochondrial genome, with its different recombinative variants , may explain seemingly contradictory results if different studies unknowingly used plants with different mitochondrial genome arrangements. Second, consider the possibility of tissue-specific or developmental stage-dependent variations in COX3 function. Third, examine environmental factors such as temperature, light conditions, and soil composition that might affect mitochondrial function and COX3 activity. Fourth, assess potential interactions with symbiotic organisms such as Rhizobium, which can significantly alter plant physiology and potentially mitochondrial function . Design controlled experiments that specifically address identified variables, incorporating technical and biological replicates to ensure reproducibility. When publishing findings, provide comprehensive methodological details including genetic background of plant material, precise growth conditions, and complete experimental protocols to enable accurate replication by other researchers.

How can bioinformatic tools be effectively used to predict the impact of mutations in the COX3 gene?

To effectively predict the impact of mutations in Vicia faba COX3, researchers should implement a comprehensive bioinformatic workflow combining structural modeling, evolutionary analysis, and functional prediction tools. Begin by generating a 3D structural model of Vicia faba COX3 using homology modeling through SWISS-MODEL or I-TASSER, based on crystallographic structures of cytochrome c oxidase from other species. Assess model quality using PROCHECK and Verify3D before proceeding with further analyses. For evolutionary context, conduct multiple sequence alignments of COX3 from diverse species to identify conserved regions using MUSCLE or MAFFT, followed by conservation scoring with ConSurf to identify functionally critical residues. To predict mutation impacts, employ PROVEAN, SIFT, and PolyPhen-2 to estimate functional consequences of amino acid substitutions based on conservation and physicochemical properties. For transmembrane topology analysis, critical for a membrane protein like COX3, utilize TMHMM or Phobius to identify transmembrane regions where mutations may disrupt membrane insertion. Molecular dynamics simulations can provide insights into how mutations affect protein stability and interactions with neighboring subunits. Finally, use protein-protein interaction prediction tools like HADDOCK to assess how mutations might impact COX3's associations with other respiratory complex subunits. This multi-tool approach provides a comprehensive assessment of potential mutation impacts from sequence to structure to function.

How can recombinant Vicia faba COX3 be utilized to investigate mitochondrial dysfunction in plants?

Recombinant Vicia faba COX3 serves as a valuable tool for investigating mitochondrial dysfunction in plants through several complementary approaches. First, purified recombinant COX3 can be used to generate specific antibodies for immunoprecipitation studies, allowing researchers to capture intact cytochrome c oxidase complexes from plant samples and assess variations in complex composition or post-translational modifications under different conditions. Second, site-directed mutagenesis of recombinant COX3 enables creation of protein variants mimicking naturally occurring mutations or designed to probe specific structure-function relationships. When reintroduced into mitochondrial systems through in organello approaches, these variants can help determine how specific amino acid changes affect complex assembly and function. Third, recombinant COX3 can serve as a standard in quantitative proteomic studies, allowing precise measurement of endogenous COX3 levels in different tissues or under stress conditions. Fourth, labeled recombinant COX3 can be used in binding studies to identify interaction partners and assess how these interactions change under conditions that induce mitochondrial dysfunction. Finally, recombinant COX3 can serve as a platform for developing biosensors to monitor mitochondrial function in vivo, potentially allowing real-time visualization of respiratory complex dynamics in living plant cells.

What is the relationship between mitochondrial COX3 function and symbiotic nitrogen fixation in Vicia faba?

The relationship between mitochondrial COX3 function and symbiotic nitrogen fixation in Vicia faba represents a complex interplay between plant energetics and symbiont metabolism. Symbiotic nitrogen fixation in faba bean, facilitated by rhizobia such as Rhizobium leguminosarum bv. viciae, is an energy-intensive process requiring substantial ATP input from the plant host . As a component of the respiratory chain, COX3 contributes to ATP production, potentially influencing the energy available for maintaining effective symbiosis. Research has identified diverse Rhizobium species in Panxi areas that nodulate faba bean, with R. anhuiense being the dominant species showing diversity at both plant growth-promoting ability and symbiosis-related gene levels . The effectiveness of this symbiosis might be influenced by mitochondrial function, with variations in COX3 potentially affecting energy provision to nodules. Additionally, under stress conditions, both mitochondrial function and symbiotic relationships can be adversely affected. Studies have shown that inoculation with specific Rhizobium strains can enhance faba bean's resistance to viral pathogens like Bean yellow mosaic virus through induced systemic resistance mechanisms , suggesting a potential feedback loop where improved plant health through symbiosis may positively impact mitochondrial function. Future research should investigate how variations in COX3 sequence or expression levels correlate with symbiotic efficiency and stress resistance in Vicia faba.

What emerging technologies will advance our understanding of Vicia faba COX3 in the next decade?

Emerging technologies poised to revolutionize Vicia faba COX3 research in the coming decade span genomics, proteomics, and advanced imaging. CRISPR-based mitochondrial genome editing, though still developing for plants, will enable precise modification of COX3 in its native context, allowing direct assessment of how sequence variations affect function. Single-molecule proteomics techniques will allow quantification of COX3 at unprecedented sensitivity, revealing low-abundance variants and post-translational modifications currently below detection thresholds. Cryo-electron microscopy will provide high-resolution structures of the entire cytochrome c oxidase complex from Vicia faba, revealing how COX3 integrates with other subunits and potentially identifying species-specific features. Advanced respirometry combined with fluorescent protein tagging will enable real-time visualization of respiratory complex assembly and function in living plant cells. Multi-omics integration platforms will correlate COX3 sequence, expression, and function with broader metabolic networks. Nanoscale sensors for oxygen consumption and membrane potential will allow measurement of COX3 function in specific subcellular compartments. These technologies will collectively provide an integrated view of how COX3 variants affect mitochondrial function, plant metabolism, stress responses, and ultimately crop productivity, potentially opening avenues for improving Vicia faba resilience through targeted breeding or biotechnological approaches focusing on mitochondrial function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.