Recombinant Vicia faba Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Vicia faba Photosystem Q(B) Protein

Vicia faba, commonly known as broad bean or faba bean, is a flowering plant belonging to the Fabaceae family . As a high-protein legume crop cultivated globally, Vicia faba holds significant importance for human and animal nutrition due to its exceptional protein content (approximately 29%) . The Vicia faba genome contains 13 GB of DNA with 34,221 predicted protein-coding genes , including the psbA gene that encodes the Photosystem Q(B) protein.

Photosystem Q(B) protein, alternatively designated as Photosystem II protein D1, serves as a fundamental component of the photosynthetic machinery. This protein is encoded by the chloroplast psbA gene and is officially classified with the Enzyme Commission number 1.10.3.9 . In scientific databases, this protein is cataloged with the UniProt accession number P13910 (PSBA_VICFA) .

Secondary and Tertiary Structure

The Photosystem Q(B) protein is an integral membrane protein primarily organized into transmembrane alpha-helical domains. It functions as part of the reaction center complex of Photosystem II, where it plays a critical role in electron transport during photosynthesis. The protein contains multiple membrane-spanning regions that anchor it within the thylakoid membrane of chloroplasts .

While the specific three-dimensional structure of Vicia faba Photosystem Q(B) protein has not been explicitly detailed in the search results, structural analyses of homologous proteins from other plant species indicate a conserved folding pattern essential for its function in electron transport chains.

Role in Photosynthesis

Photosystem Q(B) protein/D1 serves as a central component of the Photosystem II complex, which catalyzes the light-driven oxidation of water in photosynthesis. This process releases molecular oxygen, protons, and electrons, with the latter being transferred through a series of electron carriers .

The D1 protein contains binding sites for numerous cofactors involved in electron transport, including chlorophyll, pheophytin, plastoquinone, and the manganese cluster that catalyzes water oxidation. Specifically, it binds to the plastoquinone molecule known as Q(B), from which the protein derives part of its name .

Integration with Other Photosystem Components

The Photosystem II complex in higher plants consists of multiple protein subunits, including PsbQ, which is one of three main extrinsic proteins associated with the oxygen-evolving complex (OEC). PsbQ, together with lumenally bound extrinsic proteins PsbO and PsbP, is essential for the stability and full activity of the OEC in plants .

Structural analysis of PsbQ using Fourier transform infrared and circular dichroic spectroscopy, along with computational structural prediction methods, reveals that it contains approximately:

  • 53-64% alpha-helix structure

  • 7-24% beta-strand and extended structures

  • 7-14% turns

  • 14-29% non-ordered structure

This information demonstrates how Photosystem Q(B) protein functions within a complex network of photosynthetic proteins.

Expression Systems

Recombinant Photosystem Q(B) protein can be produced using various expression systems, each offering distinct advantages:

Expression SystemAdvantagesConsiderations
Escherichia coliHigh yield, short turnaround time, cost-effectiveLimited post-translational modifications
YeastGood yield, proper protein folding, some post-translational modificationsModerate cost
Insect cells with baculovirusAdvanced post-translational modifications, proper protein foldingHigher cost, longer production time
Mammalian cellsMost complete post-translational modifications, highest likelihood of retaining activityHighest cost, complex production process

The selection of an appropriate expression system depends on the specific research requirements, including protein purity, functional activity, and structural integrity needed .

Photosynthesis Research

Recombinant Vicia faba Photosystem Q(B) protein serves as a valuable tool for investigating fundamental aspects of photosynthesis. As a key component of Photosystem II, it enables researchers to study electron transport chains, light harvesting mechanisms, and oxygen evolution processes .

The availability of recombinant forms of this protein facilitates structural studies, including crystallography and spectroscopic analyses, which have contributed significantly to our understanding of photosynthetic machinery .

Signal Transduction Studies

Research involving Vicia faba has revealed intricate signal transduction pathways in guard cells, where phototropins (blue light receptors) mediate stomatal opening through activation of plasma membrane hydrogen-ATPase. Studies have shown that type 1 protein phosphatase (PP1) positively regulates the blue light signaling between phototropins and the hydrogen-ATPase in Vicia faba guard cells .

These findings demonstrate the complex regulatory networks in which photosynthetic proteins participate, extending beyond their direct roles in light reactions.

Protein-Protein Interactions

Investigations using yeast two-hybrid systems have identified proteins that interact with phototropins in Vicia faba guard cells. One such protein, Vfphot1a interacting protein (VfPIP), shows similarity to dynein light chain in its C-terminus and is primarily expressed in guard cells .

Transiently expressed VfPIP-green fluorescent protein localizes to cortical microtubules in Vicia guard cells, and microtubule-depolymerizing herbicides partially inhibit both blue light-dependent hydrogen pumping in guard cell protoplasts and stomatal opening in Vicia epidermis .

This research indicates the potential involvement of cytoskeletal components in phototropin signaling pathways, highlighting the complex cellular contexts in which photosynthetic proteins function.

Heat Stress Tolerance Studies

Recent genetic studies on Vicia faba have identified markers associated with heat tolerance, including transcription factor helix-loop-helix bHLH143-like proteins and photosystem II reaction center proteins . These findings suggest potential roles for photosystem components in stress response mechanisms, opening new avenues for crop improvement research.

Protein Identification Techniques

Mass spectrometry analysis of Vicia faba seed proteins has successfully identified numerous proteins, including components of photosynthetic machinery. This approach has revealed that most protein bands contain multiple protein types, with over 100 proteins identified across various molecular weight ranges (approximately 9-107 kDa) .

Size-exclusion high-performance liquid chromatography (SE-HPLC) has been employed to separate seed protein extracts and determine the percentages of major protein classes in Vicia faba .

Gene-to-Metabolite Correlations

Advanced research methodologies have enabled the identification of key enzymes in biosynthetic pathways of Vicia faba. For example, gene-to-metabolite correlations, gene mapping, and genetic complementation techniques were used to identify VC1 as a key enzyme in vicine and convicine biosynthesis .

Such approaches demonstrate the sophisticated research tools available for investigating protein functions in Vicia faba, which could be applied to further studies of Photosystem Q(B) protein.

Applications in Agricultural Biotechnology

The recombinant protein could serve as a tool for:

  • Developing more efficient photosynthetic systems in crops

  • Engineering plants with enhanced tolerance to environmental stresses

  • Creating biosensors for monitoring photosynthetic efficiency or environmental conditions

Protein Engineering Approaches

Advanced protein engineering techniques may be applied to:

  • Create modified versions of Photosystem Q(B) protein with enhanced stability or activity

  • Develop hybrid photosynthetic proteins with novel functions

  • Design minimal synthetic photosystems for biotechnological applications

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. If you have a specific format requirement, please indicate it in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on your location and purchase method. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Vicia faba (Broad bean) (Faba vulgaris)
Target Names
psbA
Target Protein Sequence
TAILERRDSENLWGRFCNWITTTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAVIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIVVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient, which is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the key photoreceptor proteins identified in Vicia faba?

Phototropins have been identified as critical blue light receptors in stomatal guard cells of Vicia faba. Specifically, Vicia faba phototropin 1a (Vfphot1a) and Vfphot1b serve as the primary photoreceptors mediating blue light responses. Vfphot1a interacts with a protein called VfPIP (Vfphot1a interacting protein), which shows high similarity to dynein light chain in its C-terminus. This interaction appears specific to Vfphot1a, as protein-blot and two-hybrid analyses revealed that VfPIP binds to the N-terminal region of Vfphot1a but does not bind to Vfphot1b . The interaction between VfPIP and Vfphot was further confirmed through pull-down assay methodology, suggesting a selective mechanism in the phototropin signaling pathway .

Northern analysis demonstrates that the VfPIP gene is more abundantly transcribed in guard cells compared to other tissues or cell types, indicating its specialized role in stomatal function . For researchers investigating these photoreceptors, it is essential to consider their tissue-specific expression patterns when designing experiments.

What distinguishes VfAKS proteins from other transcription factors in Vicia faba?

VfAKS (Vicia faba ABA-responsive kinase substrate) proteins belong to the basic helix-loop-helix (bHLH) transcription factor family and show distinctive characteristics that set them apart from other transcription factors. Seven VfAKS proteins (VfAKS1-7) have been identified through RNA-seq analysis, with varying expression levels in guard cells compared to leaves .

These proteins contain conserved 14-3-3 protein-binding motifs (RXXpSXP) and bHLH DNA-binding domains that are critical for their function as transcription factors . The molecular masses of these proteins vary significantly, with VfAKS1 at approximately 61.4 kDa, VfAKS2 at 54.3 kDa, and VfAKS3 at 43.9 kDa as determined by in vitro translation and SDS-PAGE analysis .

A defining characteristic of VfAKS proteins is their response to abscisic acid (ABA). VfAKS1 has been identified as the 61 kDa protein that binds to 14-3-3 proteins in an ABA-dependent manner, indicating its role in ABA signaling pathways . For research purposes, this ABA-responsive property provides a valuable experimental handle for studying hormone-dependent transcriptional regulation.

How do the expression patterns of VfAKS proteins differ between guard cells and other tissues?

RNA-seq analysis reveals distinct expression patterns of the seven identified VfAKS proteins between guard cell protoplasts (GCPs) and leaf tissues of Vicia faba. The expression levels measured in Reads Per Million (RPM) show tissue-specific distribution patterns that provide insight into the specialized functions of these transcription factors .

The experimental approach for determining these expression patterns involved:

  • Isolation of guard cell protoplasts and leaf tissues

  • RNA extraction using TRIzol Plus RNA Purification Kit

  • Construction of cDNA libraries using TruSeq RNA Sample Prep Kit

  • Sequencing on NextSeq 500 to generate 13.0-19.8 million paired-end reads per sample

  • De novo assembly using Trinity, yielding 134,130 contigs

  • Functional annotation by BLASTX against the Arabidopsis database (TAIR10)

  • Expression level calculation by mapping filtered reads to contigs using Bowtie

This methodological approach provides researchers with a framework for investigating tissue-specific expression of proteins of interest in Vicia faba.

What techniques are most effective for isolating and identifying phosphorylated proteins from Vicia faba guard cells?

Isolation and identification of phosphorylated proteins from Vicia faba guard cells requires a multi-step approach:

  • Isolation of guard cell protoplasts (GCPs): This is achieved by enzymatic digestion of epidermal strips to release individual guard cells, followed by purification steps to obtain intact GCPs .

  • Protein extraction and treatment: GCPs (330-500 μg) are suspended in buffer (5 mM MES-NaOH [pH 6.0], 10 mM KCl, 0.4 M mannitol, and 1 mM CaCl₂) and treated with ABA (10 μM) for 10 minutes in darkness to induce phosphorylation .

  • Co-immunoprecipitation: 14-3-3 binding proteins are co-immunoprecipitated using antibodies against vf14-3-3a, which selectively pulls down phosphorylated proteins that interact with 14-3-3 proteins .

  • SDS-PAGE separation: The precipitated proteins are separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, and the sample lanes are excised into 7-10 segments for subsequent analysis .

  • In-gel digestion and LC-MS/MS analysis: Excised gel segments undergo in-gel digestion followed by nano-liquid chromatography-tandem mass spectrometry (LC-MS/MS) using a Dionex U3000 Gradient Pump connected to a Q-Exactive Hybrid Quadrupole-Orbitrap Mass Spectrometer .

  • Database searching: Peptides are identified using Proteome Discoverer against a Vicia faba expression database. Search parameters include: peptide mass range (m/z) 350-1,800 Da; enzyme specificity (trypsin or LysC with up to two missed cleavages); and mass tolerances (±10 ppm for precursor ions and ±0.02 Da for peptide fragments) .

  • Validation and quantification: Peptide validation is performed using the Percolator algorithm, with only high-confidence peptides used for identification and quantification .

This comprehensive methodology allows researchers to identify phosphorylated proteins and quantify their abundance in response to hormonal treatments.

How can researchers create an expression database for Vicia faba when working with its large genome?

  • RNA extraction: Total RNA is extracted from tissues of interest (e.g., GCPs and leaves) using a TRIzol Plus RNA Purification Kit, with multiple biological replicates to ensure reliability .

  • cDNA library construction: cDNA libraries are constructed from 1 μg of total RNA using the TruSeq RNA Sample Prep Kit v.2, followed by sequencing on NextSeq 500 .

  • Read processing and quality control:

    • Adapter sequences are trimmed with bcl2fastq2

    • Low-quality bases are masked by N with original scripts

    • Only reads containing >50 non-masked bases are retained for assembly

  • De novo assembly: Trinity is used for de novo assembly of the filtered reads, which in the published study yielded 134,130 contigs .

  • Functional annotation: Contigs are functionally annotated by BLASTX analysis against an Arabidopsis database (TAIR10) .

  • Six-frame translation: For mass spectrometry determination of amino acid sequences, contigs are translated in six-frame and used as reference .

  • Expression level calculation: Filtered reads are mapped to contigs using Bowtie to calculate expression levels .

This approach provides a practical workaround for the challenges posed by the large Vicia faba genome, creating a functional expression database that can support proteomic analyses.

What are the optimal methods for in vitro translation of Vicia faba proteins?

In vitro translation of Vicia faba proteins requires careful optimization to achieve successful protein production. Based on the research with VfAKS proteins, the following methodological approach is recommended:

  • cDNA synthesis: First-strand cDNA is synthesized from total RNA extracted from target tissues (e.g., GCPs) using SuperScript II reverse transcriptase with oligo(dT)12-18 as the primer .

  • PCR amplification: The coding sequences of target proteins are amplified by PCR using the synthesized cDNA as template. For VfAKS proteins, full-length CDSs were successfully amplified by RT-PCR from cDNAs of Vicia GCPs .

  • Addition of tags (if required): For detection purposes, protein tags such as FLAG can be added through two-step PCR. This approach was used to attach N-terminal FLAG tags to VfAKS1-3 .

  • Sequence verification: PCR products should be sequenced to confirm the correct coding sequence before proceeding to in vitro transcription .

  • In vitro transcription: A commercial transcription kit (such as NUProtein) can be used to generate mRNA from the PCR products .

  • In vitro translation: The resulting RNA solutions are mixed with wheat germ extract and amino acid mix, followed by incubation at 16°C for 10 hours to allow protein synthesis .

  • Protein detection: The synthesized proteins are solubilized, separated by SDS-PAGE, and detected by immunoblotting using appropriate antibodies (e.g., anti-FLAG antibody for FLAG-tagged proteins) .

This methodology has been successfully applied to produce multiple VfAKS proteins (VfAKS1-3), allowing researchers to determine their molecular masses and study their properties .

How does the blue light signaling pathway function in Vicia faba guard cells?

The blue light signaling pathway in Vicia faba guard cells involves a complex sequence of molecular events that ultimately regulate stomatal opening. Research has revealed several key components and mechanisms:

  • Phototropin activation: Blue light activates phototropins (Vfphot1a and Vfphot1b) which serve as the primary photoreceptors in guard cells .

  • VfPIP interaction: Vfphot1a interacts specifically with VfPIP (Vfphot1a interacting protein), which shows similarity to dynein light chain. This interaction is specific to Vfphot1a and does not occur with Vfphot1b, suggesting distinct signaling pathways for different phototropins .

  • Subcellular localization: The VfPIP-green fluorescent protein fusion localizes to cortical microtubules in guard cells, indicating a potential role for the cytoskeleton in blue light signaling .

  • Microtubule involvement: Microtubule-depolymerizing herbicides partially inhibit both blue light-dependent H⁺ pumping in guard cell protoplasts and stomatal opening in the epidermis, suggesting that microtubule integrity is important for signal transduction .

  • Proton pumping: The signaling cascade ultimately leads to activation of the plasma membrane H⁺-ATPase, resulting in proton efflux and membrane hyperpolarization .

  • Ion transport: Membrane hyperpolarization drives K⁺ uptake, which along with anion accumulation, increases guard cell turgor and leads to stomatal opening .

This pathway represents a sophisticated mechanism by which plants can respond to environmental light conditions to regulate gas exchange and water loss through stomatal pores.

What mechanisms underlie ABA-dependent phosphorylation of VfAKS proteins?

ABA-dependent phosphorylation of VfAKS proteins involves several coordinated molecular events:

  • ABA perception: The process begins with ABA perception by receptor proteins, initiating a signaling cascade that activates protein kinases .

  • 14-3-3 protein binding: Upon ABA treatment (10 μM for 10 min), VfAKS1 (identified as a 61 kDa protein) binds to 14-3-3 proteins in a phosphorylation-dependent manner. This binding is highly specific, as shown by protein blot analysis using recombinant GST-14-3-3 fusion protein .

  • Phosphorylation sites: VfAKS proteins contain conserved phosphorylation sites within 14-3-3 protein-binding motifs (RXXpSXP). These sites are critical for the interaction with 14-3-3 proteins and subsequent regulation of VfAKS activity .

  • Structural changes: Phosphorylation leads to conformational changes in VfAKS proteins that affect their DNA-binding capabilities and transcriptional activity. Specific phosphorylation sites have been identified that induce monomerization of AKS1 and inhibit its transactivation activity .

  • Regulation of transcription: Phosphorylated VfAKS proteins show altered transcriptional activity, affecting the expression of ABA-responsive genes involved in stomatal closure and other drought stress responses .

This phosphorylation-dependent regulatory mechanism represents a crucial component of plant adaptation to environmental stresses, particularly drought conditions where ABA signaling plays a central role.

How do differences in sequence and structure among VfAKS proteins influence their functions?

The seven identified VfAKS proteins (VfAKS1-7) show significant variations in their sequence, structure, and expression patterns, which likely contribute to their diverse functions:

These differences likely enable the VfAKS protein family to regulate diverse aspects of plant physiology and development, with some members specialized for guard cell functions while others may play broader roles.

How should phosphoproteomics data from Vicia faba be analyzed and interpreted?

Analyzing and interpreting phosphoproteomics data from Vicia faba requires a systematic approach:

  • Database construction: Due to limited genomic information for Vicia faba, researchers should construct a customized expression database from RNA-seq data as described earlier. This database becomes the foundation for protein identification .

  • Search parameter optimization: Critical search parameters for phosphopeptide identification include:

    • Peptide mass range: 350-1,800 Da

    • Enzyme specificity: trypsin or LysC with up to two missed cleavages

    • Mass tolerances: ±10 ppm for precursor ions and ±0.02 Da for peptide fragments

    • Dynamic modifications: phosphorylation (Ser, Thr, Tyr) and oxidation (Met)

  • Validation criteria: Use algorithms like Percolator to validate peptide identifications, retaining only high-confidence peptides for further analysis .

  • Phosphosite analysis: Extract information on phosphorylated sites using filtering functions (e.g., in Microsoft Excel) to exclude peptides without phosphorylated residues .

  • Quantitative comparison: Compare peptide spectrum matches (PSMs) between experimental conditions (e.g., control vs. ABA treatment) to identify differentially phosphorylated proteins .

  • Conservation analysis: Align identified phosphosites with homologous proteins from model plants like Arabidopsis to determine conservation. For example, phosphorylation sites in VfABCG40 were compared with AtABCG40 to identify conserved and non-conserved sites .

  • Functional classification: Group phosphoproteins based on their known or predicted functions to identify enriched pathways or processes affected by the experimental treatment .

This analytical framework enables researchers to extract meaningful biological insights from complex phosphoproteomics datasets, even when working with non-model plants like Vicia faba.

What are the best practices for functional validation of recombinant Vicia faba proteins?

Functional validation of recombinant Vicia faba proteins requires a multi-faceted approach:

  • In vitro protein synthesis: Use in vitro transcription and translation systems (as described earlier) to produce recombinant proteins for initial characterization. This approach was successfully used to generate FLAG-tagged VfAKS proteins for molecular weight determination .

  • Protein-protein interaction studies: Employ multiple complementary techniques to validate interactions:

    • Yeast two-hybrid system: Used to isolate VfPIP as an interacting partner of Vfphot1a

    • Protein blot analysis: Confirmed binding specificity of VfPIP to Vfphot1a but not Vfphot1b

    • Pull-down assays: Verified the interaction between VfPIP and Vfphot

    • Co-immunoprecipitation: Used to isolate 14-3-3 binding proteins including VfAKS1

  • Subcellular localization: Express fusion proteins (e.g., GFP-tagged proteins) in guard cells to determine subcellular localization. The VfPIP-GFP fusion was localized to cortical microtubules in guard cells, providing insight into its potential function .

  • Pharmacological approaches: Use specific inhibitors to disrupt cellular components and observe effects on protein function. For example, microtubule-depolymerizing herbicides revealed the importance of microtubule integrity for blue light-dependent H⁺ pumping and stomatal opening .

  • Comparative analysis: Compare the properties and functions of Vicia faba proteins with well-characterized homologs from model plants like Arabidopsis. This approach was used to identify similarities between VfAKS proteins and Arabidopsis AKS1-6 .

  • Phosphorylation analysis: For proteins regulated by phosphorylation, analyze phosphorylation sites and their effects on protein function. This was demonstrated for VfAKS1, which binds to 14-3-3 proteins in an ABA-dependent manner via phosphorylation .

These validation approaches provide a comprehensive framework for characterizing novel proteins from Vicia faba and understanding their roles in plant physiology.

How can researchers overcome challenges associated with the large genome of Vicia faba?

The large genome of Vicia faba (approximately 13 Gb) presents significant challenges for molecular research . Researchers can adopt several strategies to overcome these limitations:

  • Transcriptome-based approaches: Rather than attempting whole-genome sequencing, focus on transcriptome analysis through RNA-seq. This approach was successfully used to construct an expression database of Vicia faba from RNA-seq data, enabling protein identification by mass spectrometry .

  • De novo assembly: Apply de novo assembly tools like Trinity to RNA-seq data, which yielded 134,130 contigs in the published study. This provides a comprehensive representation of the expressed genome without requiring a reference genome .

  • Comparative genomics: Leverage information from related model species with well-annotated genomes. The study used BLASTX analysis against the Arabidopsis database (TAIR10) for functional annotation of Vicia faba contigs .

  • Protein-centric approaches: Focus on protein-level analyses rather than genomic studies. Techniques like co-immunoprecipitation and mass spectrometry can identify and characterize proteins of interest without complete genomic information .

  • Targeted gene isolation: For specific genes of interest, use RT-PCR with primers designed based on conserved regions from related species. This approach was used to isolate full-length coding sequences of VfAKS proteins .

  • Public repository utilization: Deposit and access data in public repositories to leverage collective research efforts. The researchers deposited their RNA-seq data in the DNA Data Bank of Japan (accession number DRA012337) and proteomics data in ProteomeXchange (accession numbers PXD027057 and PXD027058) .

These strategies enable productive research on Vicia faba despite the challenges posed by its large genome, as demonstrated by the significant advances in understanding phototropin signaling and ABA-responsive proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.