Recombinant Vigna radiata var. radiata Omega-3 fatty acid desaturase, endoplasmic reticulum (ARG1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARG1; Omega-3 fatty acid desaturase, endoplasmic reticulum; Indole-3-acetic acid-induced protein ARG1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Vigna radiata var. radiata (Mung bean) (Phaseolus aureus)
Target Names
ARG1
Target Protein Sequence
MIQAQTLQHFGNGAREGDQSYFDPGAPPPFKIADIRAAIPKHCWEKSTLRSLSYVLRDVL
VVTALAASAISFNSWFFWPLYWPAQGTMFWALFVLGHDCGHGSFSNSSKLNSFVGHILHS
LILVPYNGWRISHRTHHQNHGHVEKDESWVPLTEKVYKNLDDMTRMLRYSFPFPIFAYPF
YLWNRSPGKEGSHFNPYSNLFSPGERKGVVTSTLCWGIVLSVLLYLSLTIGPIFMLKLYG
VPYLIFVMWLDFVTYLHHHGYTHKLPWYRGQEWSYLRGGLTTVDRDYGWINNVHHDIGTH
VIHHLFPQIPHYHLVEATKSAKSVLGKYYREPQKSGPLPFHLLKYLLQSISQDHFVSDTG
DIVYYQTDPKLHQDSWTKSK
Uniprot No.
Target Background
Function
Microsomal (ER) omega-3 fatty acid desaturase catalyzes the introduction of the third double bond in the biosynthesis of 18:3 fatty acids, crucial components of plant membranes. It is believed to utilize cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and potentially other phospholipids.
Database Links
KEGG: vra:106775023
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
