Recombinant Vigna unguiculata Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant psbA proteins from other species (e.g., barley, tomato, cyanobacteria) have been successfully expressed in E. coli and Pichia pastoris . For Vigna unguiculata, hypothetical expression strategies would likely follow similar protocols:

ParameterDetails
Expression HostE. coli or Pichia pastoris (common for plant proteins)
VectorpGAPZB (for yeast) or pET-based plasmids (for E. coli)
TagN-terminal His-tag for purification
Yield≥85% purity achievable via affinity chromatography (Ni-NTA)
Protein LengthFull-length mature protein (e.g., 343 amino acids in algal homologs)

Research Gaps and Challenges

  • Species-Specific Data: No peer-reviewed studies explicitly detail the cloning, expression, or characterization of Vigna unguiculata psbA. Existing references focus on genomic analyses of cowpea or unrelated proteins like phospholipase D .

  • Technical Hurdles:

    • Hydrophobic nature complicates solubility .

    • Requires chloroplast-specific chaperones for functional assembly .

Potential Applications

ApplicationRelevance
Herbicide ResistanceStudy QB-site mutations for agrochemical development .
Stress ToleranceEngineer crops with enhanced PSII repair under drought/oxidative stress .
Structural BiologyFacilitate cryo-EM studies of PSII complexes .

Comparative Analysis of psbA Homologs

SpeciesExpression HostKey FindingsReference
Synechocystis sp. PCC 6803E. coliRetains herbicide-binding capacity; used in antibody production .
Solanum lycopersicumE. coliFull-length D1 expressed with His-tag; used in PSII repair studies .
Hordeum vulgare (barley)E. coliBinds chlorophyll and atrazine after renaturation .

Future Directions

  • Heterologous Expression: Optimize codon usage and fusion tags for Vigna unguiculata psbA .

  • Functional Assays: Validate electron transport activity via chlorophyll fluorescence .

  • Omics Integration: Combine transcriptomic and proteomic data to identify PSII repair factors .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Vigna unguiculata (Cowpea)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGSSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that is subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Photosystem Q(B) protein in Vigna unguiculata?

Photosystem Q(B) protein (psbA) in Vigna unguiculata functions as a core component of Photosystem II with an enzymatic classification of EC 1.10.3.9. Structurally, it is a 32 kDa thylakoid membrane protein encoded by the psbA gene . The protein consists of 344 amino acids (expression region 2-344) with a full amino acid sequence as documented in the UniProt database (accession number Q33282) .

The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, where it plays a crucial role in the electron transport chain during photosynthesis. Specifically, it binds to quinone molecules and facilitates electron transfer from the primary quinone acceptor (QA) to the secondary quinone acceptor (QB) . This electron transfer is fundamental to the light-dependent reactions of photosynthesis and the generation of ATP.

How does psbA protein respond to environmental stresses in cowpea plants?

The psbA protein demonstrates significant adaptive responses to environmental stresses in cowpea plants. Under high temperature (HT) and high light (HL) conditions, there is a notable shift in the redox state of the primary quinone acceptor (QA), which becomes more oxidized with increasing temperature, particularly dependent on light intensity . This oxidation suggests an increased electron sink capacity despite reduced CO2 fixation.

Additionally, proteomic studies have revealed that under combined biotic and abiotic stresses, psbA and related photosynthetic proteins undergo significant changes in abundance. For instance, when cowpea plants are subjected to combined nematode infestation and drought stress, several major photosynthetic proteins involved in light reactions and carbon assimilation, including components of PSII where psbA functions, show at least a 2-fold decrease in abundance . This coordinated downregulation appears to be part of the plant's stress response mechanism.

What experimental methods are commonly used to study psbA protein expression and activity?

Several methodological approaches are employed to study psbA protein expression and activity:

  • Chlorophyll fluorescence measurements: Using instruments like MultispeQ V1 or DEPI platforms to determine maximal PSII efficiency (FV/FM) and connect PSII function with downstream reactions .

  • Electrochromic shift assay: Conducted simultaneously with chlorophyll fluorescence measurements to assess thylakoid conductivity to protons and ATP synthase activity .

  • Gas exchange measurements: Using instruments like LICOR 6800 to perform A/Ci analyses that help understand CO2 assimilation rates and rubisco activation states .

  • Proteomic analysis: Employing techniques such as chromatogram alignment and peptide quantification using software like Progenesis QI for Proteomics, followed by protein identification using tools like Peaks® 7.0 .

  • Transcriptomic analysis: Using RNA sequencing platforms like Illumina Novaseq 6000 to identify gene expression patterns related to psbA under various stress conditions .

How can researchers optimize experimental designs to study psbA protein dynamics under combined stress conditions?

When designing experiments to study psbA protein dynamics under combined stress conditions, researchers should consider the following methodological approach:

  • Controlled environment chambers: Establish precise control over multiple stress parameters simultaneously. For studying high temperature and high light interactions, use growth chambers capable of maintaining temperatures from 25°C to 40°C while providing light intensities ranging from 100 to 1000 μmol photons m⁻² s⁻¹ .

  • Factorial experimental design: Implement a full factorial design that includes all combinations of stress factors (e.g., temperature × light intensity × drought × biotic stress) to identify interaction effects. This should include appropriate controls for each stress factor individually .

  • Time-course measurements: Integrate temporal dynamics by taking measurements at multiple time points following stress application (immediate, short-term, and long-term responses).

  • Multi-level analysis approach: Combine techniques across different biological scales:

    • Molecular level: Transcriptomics and proteomics

    • Biochemical level: Enzyme activity assays

    • Physiological level: Gas exchange and chlorophyll fluorescence

  • Statistical consideration: Use multivariate statistical approaches like Principal Component Analysis (PCA) to analyze complex datasets with multiple interacting variables, as demonstrated in proteomic studies of stress responses in Vigna unguiculata .

An effective approach is demonstrated in studies where chlorophyll fluorescence measurements were performed simultaneously with gas exchange measurements, allowing researchers to correlate changes in photosynthetic parameters directly with alterations in psbA function .

What are the current challenges in interpreting contradictory data regarding psbA responses to high temperature and high light conditions?

Researchers face several methodological challenges when interpreting seemingly contradictory data regarding psbA responses:

  • Differential regulation of light reactions versus carbon assimilation: Studies have observed contrasting responses where light reactions are stimulated while CO2 assimilation is substantially reduced under high temperature and high light conditions . This apparent contradiction reflects complex regulatory mechanisms rather than experimental error.

  • Variable electron sink capacity: The observation that QA becomes more oxidized with increasing temperature, suggesting increased electron sink capacity despite reduced CO2 fixation, presents an interpretive challenge . Researchers must distinguish between multiple potential electron sinks including photorespiration and O2-dependent alternative pathways.

  • Differential stress thresholds: Different components of the photosynthetic apparatus may have different tolerance thresholds for stress factors, resulting in asynchronous responses that can appear contradictory if not measured at appropriate time intervals.

  • Methodological considerations: Different techniques for measuring photosynthetic parameters (gas exchange versus chlorophyll fluorescence) may yield apparently contradictory results because they assess different aspects of the photosynthetic process.

To address these challenges, researchers should:

  • Incorporate O2-dependent measurements alongside CO2 assimilation studies

  • Simultaneously measure multiple parameters including electron transport rate, QA redox state, and rubisco activation

  • Consider the role of PSII repair mechanisms, which may maintain electron flow even when assimilation is suppressed

  • Use integrated approaches that combine transcriptomic, proteomic, and physiological measurements

How does the methodology for analyzing psbA functional dynamics differ between mature and developing leaves?

The methodology for analyzing psbA functional dynamics differs significantly between mature and developing leaves in Vigna unguiculata, requiring specific experimental considerations:

  • Leaf selection protocol: Researchers should establish clear criteria for leaf maturity classification. In cowpea studies, researchers have focused on leaves of different maturity to determine relative effects on assimilation and light reactions and their co-regulation .

  • Baseline parameter adjustment: When comparing psbA function between leaf developmental stages:

    • Normalize chlorophyll fluorescence parameters against total chlorophyll content, which varies with leaf maturity

    • Establish baseline photosynthetic capacity for each developmental stage before applying stress treatments

    • Account for differences in rubisco content and activation state between mature and developing leaves

  • Differential analysis approaches:

    • For mature leaves: Focus on steady-state measurements of photosynthetic parameters

    • For developing leaves: Incorporate developmental trajectory analyses to account for ongoing changes in photosynthetic apparatus

  • Statistical handling: Apply appropriate statistical methods such as unbalanced ANOVA when there are unequal sample sizes between leaf maturity groups, as demonstrated in studies of cowpea responses to environmental stresses .

  • Interpretation framework: Develop a framework that accounts for developmental differences in:

    • Photosynthetic protein abundance

    • Thylakoid membrane organization

    • Stress response mechanisms

    • Gene expression patterns

This differential approach is particularly important as developing leaves may show distinct responses to environmental stresses compared to mature leaves, potentially employing different protective mechanisms involving psbA protein.

How do photorespiration pathways interact with psbA function under combined high temperature and high light stress?

The interaction between photorespiration pathways and psbA function under combined high temperature and high light stress is complex and physiologically significant. Research has revealed the following key interactions:

Experimentally, these interactions can be studied by manipulating O2 and CO2 concentrations while measuring chlorophyll fluorescence parameters and gas exchange. The dependence of photosynthetic responses on both gases provides evidence for photorespiration's role in maintaining psbA function under stress conditions .

What molecular mechanisms regulate psbA protein turnover under abiotic stress conditions in cowpea?

The molecular mechanisms regulating psbA (D1 protein) turnover under abiotic stress conditions in cowpea involve several coordinated processes:

  • PSII repair cycle acceleration: Research indicates that increased electron flow under combined high light and high temperature conditions is maintained by rapid rates of PSII repair, particularly of the D1 protein (psbA) . This repair mechanism prevents photodamage to the light reactions even when assimilation is strongly suppressed.

  • Protease-mediated degradation: Under stress conditions, damaged D1 proteins are recognized by specific proteases that cleave the protein, allowing for its removal from the PSII complex. This degradation step is often the rate-limiting factor in the repair cycle.

  • De novo synthesis regulation: The synthesis of new psbA protein involves transcriptional and translational regulation. Proteomic studies in cowpea have identified coordinated decreases in several photosynthetic proteins under combined stress conditions, including components involved in the biosynthesis of chlorophyll and proteins associated with PSII .

  • Chaperone involvement: Molecular chaperones like rubisco activase (which was found to be reduced by FC 1.4 under stress conditions) may play dual roles in both rubisco regulation and protection of PSII components including psbA .

  • Redox signaling: Changes in the redox state of the primary quinone acceptor (QA) under high temperature and high light conditions suggest a regulatory role of redox signaling in psbA turnover and PSII repair processes .

These regulatory mechanisms ensure that psbA turnover is precisely controlled to maintain photosynthetic efficiency even under challenging environmental conditions.

How does the presence or absence of specific single-nucleotide polymorphisms (SNPs) in photosynthetic genes affect psbA function under salt stress?

The presence or absence of specific SNPs in photosynthetic genes can significantly affect psbA function under salt stress in Vigna unguiculata. Research on salt stress responses in cowpea has revealed:

  • Genotype-specific responses: Transcriptome analysis identified significant expression level differences in 27 genes between salt-tolerant and salt-sensitive cowpea germplasms . While not specifically identifying psbA, the study revealed important mechanisms that could influence photosynthetic protein function.

  • Functional SNP variations: Two salt stress-related genes (Vigun_02G076100 and Vigun_08G125100) with SNP variations were identified as particularly important for salt tolerance . One SNP in Vigun_02G076100 caused significant amino acid variation, while all nucleotide variations in Vigun_08G125100 were classified as missing in salt-resistant germplasms. These genetic variations may indirectly affect psbA function by altering signaling pathways or protective mechanisms under salt stress.

  • Missing allele phenomenon: The complete absence of certain alleles in salt-resistant cowpea varieties suggests that gene loss may sometimes contribute to stress tolerance mechanisms . This has implications for how researchers should approach the study of psbA function across different cowpea germplasms.

  • Methodological approach to SNP analysis: The research demonstrates a valuable methodological approach for identifying and validating SNPs related to stress tolerance:

    • Initial screening using RNA sequencing

    • Confirmation using DNA-seq and PCR analysis

    • Development of molecular markers (such as KASP markers) for breeding programs

This methodology could be applied to investigate SNPs specifically in the psbA gene and their relationship to photosynthetic performance under salt stress.

What are the most effective protocols for isolating and purifying recombinant psbA protein while maintaining its structural integrity?

Effective isolation and purification of recombinant psbA protein while maintaining its structural integrity requires careful consideration of several critical factors:

  • Buffer optimization: Use Tris-based buffer with 50% glycerol, which has been optimized for maintaining the stability of recombinant Vigna unguiculata Photosystem Q(B) protein . This buffer composition helps maintain the native conformation of the protein's multiple transmembrane domains.

  • Temperature control protocol:

    • Store the purified protein at -20°C for routine storage

    • Use -80°C for extended storage periods

    • Create working aliquots that can be stored at 4°C for up to one week

    • Avoid repeated freezing and thawing cycles, which can significantly compromise structural integrity

  • Expression system selection: When producing recombinant psbA, researchers must carefully select expression systems that can properly handle the insertion of membrane proteins with multiple transmembrane domains. Bacterial systems may require modifications to accommodate the hydrophobic regions of the protein.

  • Tag design considerations: The tag type should be determined during the production process based on protein-specific requirements . For psbA, N-terminal tags are generally preferred over C-terminal tags to avoid interfering with membrane insertion.

  • Purification methodology: A multi-step purification approach is recommended:

    • Initial capture using affinity chromatography based on the selected tag

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography to ensure removal of aggregates

Following these protocols will help maintain the structural integrity of psbA protein, which is essential for downstream functional studies and structural analyses.

How can researchers effectively differentiate between native and recombinant forms of psbA protein in experimental systems?

Differentiating between native and recombinant forms of psbA protein requires a combination of analytical techniques and experimental controls:

  • Tag-based identification: Incorporate specific tags during the recombinant protein production process. These tags not only facilitate purification but also provide a means to distinguish recombinant from native protein . Western blot analysis using anti-tag antibodies can specifically detect only the recombinant form.

  • Mass spectrometry approach: Employ proteomics techniques similar to those used in cowpea stress response studies :

    • Use Progenesis QI for Proteomics software for chromatogram alignment and peptide quantification

    • Perform protein identification using Peaks® 7.0 software with parameters optimized for Vigna unguiculata proteins

    • Set tolerance for precursor mass of 10 ppm and fragments of 0.05 Da

    • Apply FDR < 1% for significant identification

  • Sequence-specific detection: Design antibodies or nucleic acid probes that target regions unique to either the recombinant or native form. For instance, if the recombinant psbA contains the full 344 amino acid sequence expressed from region 2-344 , probes can be designed to detect any modifications at the termini.

  • Functional assays: Develop assays that can distinguish between native and recombinant protein based on functional differences:

    • Electron transfer capacity

    • Binding affinity to quinone molecules

    • Interaction with other components of the photosynthetic apparatus

  • Expression pattern analysis: In experimental systems where both forms might be present, monitor their expression patterns under different conditions to establish distinct profiles for each form.

These approaches enable researchers to accurately track and quantify recombinant psbA protein in their experimental systems, ensuring reliable interpretation of results.

What techniques provide the most accurate quantification of psbA protein levels in plant tissue samples under different environmental conditions?

Accurate quantification of psbA protein levels in plant tissue samples under different environmental conditions requires sophisticated techniques that account for the protein's membrane-bound nature and potential changes in extraction efficiency:

  • Quantitative proteomics workflow:

    • Sample preparation: Optimize extraction buffers for membrane proteins

    • Separation: Use 2D gel electrophoresis or liquid chromatography

    • Detection: Employ mass spectrometry with stable isotope labeling

    • Quantification: Apply Progenesis QI for Proteomics software for chromatogram alignment and peptide quantification

    • Identification: Use Peaks® 7.0 software with parameters specific for Vigna unguiculata

  • Western blot analysis with internal standards:

    • Include recombinant psbA protein standards at known concentrations

    • Use specific antibodies against conserved regions of the D1 protein

    • Apply densitometry analysis with standard curves

    • Calculate absolute protein amounts based on signal intensity comparison

  • ELISA-based quantification:

    • Develop sandwich ELISA using antibodies against different epitopes of psbA

    • Create standard curves using purified recombinant protein

    • Account for matrix effects by using appropriate sample dilutions

    • Calculate protein concentration based on colorimetric or fluorescent signals

  • Correction for extraction efficiency:

    • Use spike-in controls of known quantities of recombinant psbA

    • Calculate recovery rates under different experimental conditions

    • Apply correction factors to account for changes in extraction efficiency

  • Data analysis and normalization:

    • Apply ANOVA test (p < 0.05) and fold change ≥1.1 to identify significantly different abundance levels

    • Use multivariate statistical analysis—PCA for grouping according to relative abundance profiles

    • Normalize protein levels to appropriate reference proteins or total protein content

These techniques ensure accurate quantification of psbA protein levels even when environmental conditions might affect protein extraction or stability.

How does the function of psbA in Vigna unguiculata compare to its homologs in other plant species under similar stress conditions?

A comparative analysis of psbA function in Vigna unguiculata versus its homologs in other plant species reveals both conserved and species-specific responses to environmental stresses:

  • Conserved functional domains: The psbA protein in cowpea maintains the highly conserved functional domains found across photosynthetic organisms, particularly the quinone binding sites essential for electron transport . This conservation reflects the fundamental role of psbA in photosynthesis across species.

  • Stress response variations: Under high temperature and high light conditions, cowpea exhibits distinctive responses that may differ from other species:

    • Increased oxidation of the primary quinone acceptor (QA) with rising temperature

    • Strong O2-dependent inactivation of assimilation capacity

    • Maintenance of electron flow through rapid PSII repair mechanisms

  • Adaptive advantages in cowpea: Cowpea is adapted to arid and semiarid regions with high temperature and light intensities. Research indicates it exhibits considerable genetic variation in tolerance to these stresses , suggesting that psbA function in cowpea may have evolved specific regulatory mechanisms for these conditions.

  • Methodological considerations for comparative studies:

    • Use standardized stress application protocols across species

    • Employ identical measurement techniques for photosynthetic parameters

    • Account for physiological differences in baseline photosynthetic rates

    • Consider evolutionary relationships when interpreting functional differences

  • Integrative research approach: To fully understand species differences, researchers should combine:

    • Sequence analysis of psbA across species

    • Structural modeling of protein variations

    • Functional assays under identical stress conditions

    • Analysis of regulatory networks controlling psbA expression and turnover

These comparative approaches help identify both fundamental mechanisms of photosynthetic stress response and species-specific adaptations that may inform crop improvement strategies.

What experimental designs can effectively evaluate the functional differences between wild-type and mutant forms of psbA protein?

Effective experimental designs for evaluating functional differences between wild-type and mutant forms of psbA protein require comprehensive approaches that span multiple levels of analysis:

  • Site-directed mutagenesis strategy:

    • Target specific amino acids in the psbA sequence based on the full amino acid sequence information available for Vigna unguiculata

    • Focus on conserved regions identified through alignment with psbA sequences from other species

    • Create a series of mutants with substitutions at key functional sites, particularly those involved in quinone binding

  • Expression system optimization:

    • Develop both in vitro and in vivo expression systems

    • For in vitro: Cell-free translation systems with appropriate membrane mimetics

    • For in vivo: Transformation protocols for cowpea or model organisms like Arabidopsis

  • Multi-level functional assessment:

    • Molecular level: Binding assays for quinone interaction

    • Protein level: Structural stability and folding analysis

    • Complex level: PSII assembly and stability studies

    • Physiological level: Photosynthetic parameter measurements

  • Stress response characterization:

    • Subject wild-type and mutant forms to graduated stress conditions:

      • Temperature series (25°C to 40°C)

      • Light intensity series (100 to 1000 μmol photons m⁻² s⁻¹)

      • Combined stresses with controlled parameters

    • Measure key parameters including:

      • Chlorophyll fluorescence using MultispeQ V1 or DEPI platforms

      • Gas exchange parameters using systems like LICOR 6800

      • Electron transport rates and QA redox state

  • Data analysis framework:

    • Apply statistical approaches such as 2 or 3-way ANOVA to determine differences and interactions between treatments

    • Use unbalanced ANOVA when there are unequal sample sizes

    • Perform means separation by Tukey's honestly significant difference (HSD) test

This comprehensive experimental approach enables researchers to thoroughly characterize functional differences between wild-type and mutant psbA proteins, particularly under stress conditions relevant to agricultural settings.

How can researchers correlate changes in psbA protein abundance with modifications in photosynthetic efficiency under field conditions?

Correlating changes in psbA protein abundance with modifications in photosynthetic efficiency under field conditions requires a methodologically rigorous approach that bridges laboratory precision with field reality:

  • Field-adaptable sampling protocol:

    • Develop standardized leaf disc collection methods that preserve protein integrity

    • Implement immediate flash-freezing in liquid nitrogen

    • Establish time-course sampling to capture diurnal variations

    • Create detailed environmental data collection protocols (temperature, light, humidity)

  • Portable measurement integration:

    • Deploy MultispeQ V1 linked to the photosynQ platform for in-field chlorophyll fluorescence measurements

    • Use portable gas exchange systems for simultaneous photosynthetic rate measurements

    • Correlate these immediate physiological measurements with subsequent protein quantification

  • Protein abundance quantification:

    • Process field samples using optimized extraction protocols for membrane proteins

    • Apply quantitative proteomics workflows as described in proteomic studies of stress responses

    • Use recombinant psbA protein standards for absolute quantification

  • Correlation analysis framework:

    • Develop mathematical models relating psbA abundance to photosynthetic parameters

    • Account for environmental variables using multiple regression approaches

    • Apply time-series analysis to track changes over diurnal cycles or growing seasons

  • Validation experiments:

    • Conduct parallel controlled environment studies that simulate field conditions

    • Perform targeted manipulation of psbA levels through molecular approaches

    • Use these validation experiments to establish causation beyond correlation

This integrated approach allows researchers to establish meaningful relationships between psbA protein abundance and photosynthetic efficiency under real-world conditions, providing insights that bridge fundamental research and agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.