Recombinant Viral hemorrhagic septicemia virus Spike glycoprotein (G)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Viral Hemorrhagic Septicemia Virus Spike Glycoprotein (G)

Viral Hemorrhagic Septicemia Virus (VHSV) is a highly contagious virus known to cause high mortality rates in a wide range of freshwater and marine fish species . The glycoprotein, or G protein, of VHSV, is a major surface protein responsible for the virus's attachment to and entry into host cells . This protein is found only in enveloped viruses, where it forms trimeric spikes connected to a lipid bilayer derived from the host cell membrane . The G protein plays a crucial antigenic role by triggering significant host immune responses . The nucleotide sequence encoding the G-protein has been widely used as the preferred molecular marker to assess the VHSV genetic diversity and evolution .

Structure and Function of the G Protein

The G protein, a 72–80 kDa viral glycoprotein antigen, is encoded by the G-gene, which consists of 1,524 bases encoding 508 amino acids . As the major surface protein, the G protein is heavily glycosylated and forms spike-like projections on the surface of mature virions . It is a key component responsible for VHSV cross-species transmission and the emergence of infections . The G-protein is involved in viral emergence and replication . Mutations within the G-gene enhance the viral attachment and penetration into the host’s cell and facilitate the virus to evade the host’s immune responses .

Role in Viral Entry and Fusion

The envelope spike protein (E) is another important component of VHSV and is responsible for membrane fusion during viral entry into host cells . The E protein interacts with the G protein and the matrix protein M1 to mediate fusion between the viral envelope and the host cell membrane .

Genetic Diversity and Evolution

Phylogenetic analysis based on the nucleotide sequences of G and N genes of VHSV isolates from marine and freshwater fish species suggests the existence of four genotypes (I–IV) and several sub-lineages of genotypes I and IV (Ia–Ie and IVa–IVb) . The distribution of these genotypes appears to be geographically specific rather than host-specific . Specifically, genotypes I, II, and III are predominantly isolated from Europe, while genotype IV isolates are sampled from North America and Asia .

Virulence Markers and Amino Acid Substitutions

Several studies have explored the G protein's role in VHSV virulence by examining the effects of specific amino acid substitutions on viral-induced mortality .

Amino Acid SubstitutionEffect on rVHSV Virulence in TroutEffect on Viral Titer In Vitro (EPC Cells)
D51ENo effect (p>0.05p > 0.05) Not reported
T277ANo effect (p>0.05p > 0.05) Not reported
R283KNo effect (p>0.05p > 0.05) Not reported
V290INo effect (p>0.05p > 0.05) Not reported
T135AStrongly attenuated (p<0.001p < 0.001) Roughly 1 log reduction

The T135A substitution in the G protein significantly attenuates VHSV virulence in trout, leading to a lower replication rate in EPC cells . This finding suggests that the G protein plays a vital role in VHSV virulence in rainbow trout .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To ensure your desired tag type, please specify it upon ordering; we will prioritize its implementation.
Synonyms
G; Spike glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-507
Protein Length
full length protein
Species
Viral hemorrhagic septicemia virus (strain 07-71) (VHSV)
Target Names
G
Target Protein Sequence
QITQRPPVENISTYHADWDTPLYTHPSNCRDDSFVPIRPAQLRCPHEFEDINKGLVSVPT RIIHLPLSVTSVSAVASGHYLHRVTYRVTCSTSFFGGQTIEKTILEAKLSRQEATDEASK DHEYPFFPEPSCIWMKNNVHKDITHYYKTPKTVSVDLYSRKFLNPDFIEGVCTTSPCQTH WQGVYWVGATPKAHCPTSETLEGHLFTRTHDHRVVKAIVAGHHPWGLTMACTVTFCGTEW IKTDLGDLIQVTGPGGTRKLTPNKCVNTDIQMRGATDDFSYLNHLITNMAQRTECLDAHS DITASGKVSSFLLSKFRPSHPGPGKAHYLLDGQIMRGDCDYEAVVSINYNRAQYKTMNNT WKSWKRVDNNTDGYDGMIFGDKLIIPDIEKYQSVYDSGMLVQRNLVEVPHLSIVFVSNTS DLSTNHIHTNLIPSDWSFNWSLWPSLSGMGVVGGAFLLLVLCCCCKASPPIPNYGIPMQQ FSRSQTV
Uniprot No.

Target Background

Function

This protein comprises the viral spikes on the virion surface. It mediates both viral attachment to susceptible host cells and subsequent cellular uptake. The interaction between the virion's internal components and the glycoprotein's cytoplasmic membrane portion likely directs viral envelopment and budding.

Protein Families
Novirhabdovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the structure and function of VHSV glycoprotein?

VHSV glycoprotein (G) is the major surface protein of the viral hemorrhagic septicemia virus, a member of the Rhabdoviridae family, genus Novirhabdovirus. The virus has a bullet-shaped structure approximately 70 nm in diameter and 180 nm in length, with the G protein forming projections on the viral envelope. This glycoprotein functions as the primary antigen that induces neutralizing antibodies in fish and is responsible for viral attachment to host cells .

Structurally, the G protein is anchored in the viral envelope via a transmembrane domain, with most of the protein exposed on the virion surface. The protein undergoes post-translational modifications, particularly glycosylation, which significantly influences its antigenic properties. Research has shown that the glycoprotein's fusion activity is pH-dependent, with membrane fusion being inhibited at pH values exceeding 6.2, which is slightly higher than the pH threshold observed in other rhabdoviruses .

How is recombinant VHSV glycoprotein produced in laboratory settings?

The recombinant production of VHSV glycoprotein involves several methodological approaches, with baculovirus expression systems in insect cells being the most widely documented. The protocol typically follows these steps:

  • Isolation and amplification of the VHSV G gene using reverse transcription PCR (RT-PCR)

  • Cloning of the G gene into a suitable transfer vector (e.g., pBacSHVG)

  • Co-transfection of insect cells (typically Spodoptera frugiperda Sf9 cells) with the recombinant transfer vector and wild-type baculovirus DNA

  • Selection and purification of recombinant viruses through plaque assays

  • Infection of Sf9 cell suspensions with the selected recombinant baculovirus

  • Harvesting cells 4 days post-infection and storage at -70°C until processing

  • Verification of expression through immunoblotting using VHSV G-specific monoclonal antibodies

This system produces recombinant glycoprotein with properties similar to the native viral protein, though with slight differences in molecular weight and glycosylation patterns as observed by SDS-PAGE analysis .

What are the key antigenic regions of VHSV glycoprotein important for vaccine development?

Multiple studies have identified specific regions within the VHSV glycoprotein that are particularly important for immunogenicity and antiviral responses. Pepscan mapping has revealed that amino acid residues 280 to 310 and 340 to 370 of the VHSV glycoprotein are critical for inducing type I interferon responses and triggering the expression of antiviral genes such as mx, thereby restricting viral spread .

These regions represent potential targets for rational vaccine design, as they appear to interact with host cell receptors, possibly integrins, to initiate protective immune responses. Additionally, studies using virus-neutralizing monoclonal antibodies have demonstrated that the expression of VHSV glycoprotein on cell surfaces is more important for inducing interferon than the mere presence of viral gpG gene transcripts inside cells . This knowledge guides researchers in designing recombinant vaccines that properly display these critical antigenic determinants.

How does the efficacy of recombinant VHSV glycoprotein compare to other vaccine approaches?

The efficacy of different VHSV vaccine approaches can be compared based on their ability to induce neutralizing antibodies and protect against virus challenge. The table below summarizes comparative data from research studies:

Vaccine TypeAdministration RouteNeutralizing Antibody ResponseProtection Against ChallengeSafety Profile
Recombinant VHSV G (baculovirus)Intraperitoneal injectionStrongHighExcellent
Recombinant VHSV G (baculovirus)ImmersionPoor/NoneLowExcellent
Inactivated VHSVIntraperitoneal injectionModerate to StrongModerate to HighGood
Attenuated VHSVIntraperitoneal injectionStrongHighModerate
Attenuated VHSVImmersionModerateModerateModerate

What molecular mechanisms underlie the failure of immersion vaccination with recombinant VHSV glycoprotein?

The failure of immersion vaccination with recombinant VHSV glycoprotein likely involves multiple factors related to antigen delivery, mucosal immune responses, and conformational considerations. When analyzing this phenomenon, researchers must consider:

  • Antigen stability in water: Recombinant proteins may undergo degradation or conformational changes in aqueous environments, potentially reducing their immunogenicity when administered via immersion.

  • Mucosal uptake mechanisms: Unlike native virions that have evolved mechanisms to penetrate mucosal barriers, recombinant proteins may lack efficient translocation across fish epithelial surfaces. Research indicates that the viral epitopes responsible for inducing protection are located on the surface glycoprotein, but proper presentation may be compromised in recombinant formulations .

  • Adjuvant requirements: Immersion vaccination might require specific adjuvants to enhance immune recognition and response. Studies suggest that interactions between VHSV glycoprotein and integrins might trigger host interferon-mediated antiviral responses , and these interactions may be suboptimal with recombinant proteins in immersion settings.

  • Glycosylation patterns: Evidence from rhabdovirus research indicates that glycosylation of G protein is crucial for inducing neutralizing antibody responses . The baculovirus-expressed VHSV G protein displays different glycosylation patterns compared to native viral protein, which may affect its immunogenicity via mucosal routes.

Methodologically, addressing these challenges requires comparative immunological studies examining mucosal immune responses and antigen uptake mechanisms using techniques such as immunohistochemistry, flow cytometry, and transcriptomic analysis of immune-related genes in mucosal tissues following different vaccination strategies.

How can reverse genetics be applied to enhance VHSV glycoprotein-based vaccines?

Reverse genetics represents a powerful approach for rational vaccine design involving VHSV glycoprotein. This methodology enables precise manipulation of the viral genome to optimize immunogenicity and safety profiles. Recent advances in this field have demonstrated several promising strategies:

  • Gene rearrangement: Modifying the order of genes in the VHSV genome can alter the transcription gradient of viral proteins. Research has successfully generated recombinant VHSVs with rearranged genomes, termed NxGyCz according to the positions of nucleoprotein (N), glycoprotein (G), and expression cassette (C) genes . This approach allows researchers to modulate the expression levels of glycoprotein to optimize immunogenicity.

  • Bivalent/multivalent vaccine development: Reverse genetics enables the incorporation of heterologous antigens into the VHSV genome. For example, researchers have engineered VHSV to express the major protective antigen domain of nervous necrosis virus (NNV) capsid protein, creating a bivalent vaccine candidate against both VHSV and NNV infections . This was achieved by fusing the NNV Linker-P specific domain to signal peptide (SP) and transmembrane domain (TM) derived from novirhabdovirus glycoprotein.

  • Targeted attenuation: The VHSV genome can be modified to produce attenuated viruses that maintain immunogenicity while reducing virulence. This balances safety and efficacy considerations for live attenuated vaccines.

  • Chimeric glycoproteins: Creating chimeric proteins that combine the most immunogenic epitopes from different VHSV strains or genotypes can potentially provide broader protection against diverse viral variants, addressing the challenge of genetic diversity among the four main VHSV genotypes .

Implementation of reverse genetics approaches requires specialized molecular biology techniques, including site-directed mutagenesis, assembly PCR, and rescue systems for recovering recombinant viruses from cloned cDNA.

What are the optimal parameters for enhancing recombinant VHSV glycoprotein immunogenicity?

Enhancing the immunogenicity of recombinant VHSV glycoprotein requires careful optimization of multiple parameters throughout production, formulation, and delivery. Key considerations include:

Production parameters:

  • Expression system selection: While baculovirus-insect cell systems have been successful, mammalian or fish cell expression systems might provide more appropriate glycosylation patterns .

  • Purification methods: Techniques that preserve native conformation are essential, as studies indicate that conformational epitopes are critical for inducing neutralizing antibodies.

  • Post-translational modifications: Research suggests that glycosylation is crucial for inducing neutralizing antibody responses in rhabdovirus glycoproteins .

Formulation considerations:

  • Adjuvant selection: Appropriate adjuvants can significantly enhance immune responses, particularly for subunit vaccines.

  • Stability enhancers: Compounds that stabilize protein conformation during storage and delivery.

  • Delivery vehicles: Microspheres, nanoparticles, or liposomes might improve antigen presentation and immune recognition.

Immunization protocols:

  • Route of administration: Intraperitoneal injection has proven effective, while immersion requires further optimization .

  • Dosage and scheduling: Multiple smaller doses might enhance immune memory compared to single large doses.

  • Environmental factors: Water temperature significantly affects fish immune responses and should be considered when designing vaccination protocols.

Research methodologies to determine optimal parameters should include systematic testing of formulations in controlled challenge studies, measuring both antibody responses (neutralizing titers) and cellular immunity markers, followed by protective efficacy assessment through virus challenge experiments.

How does the VHSV glycoprotein interact with fish immune cells to trigger antiviral responses?

The VHSV glycoprotein triggers sophisticated immunological cascades in fish, initiating both innate and adaptive immune responses. Current research suggests the following interaction mechanisms:

  • Integrin recognition: Evidence indicates that VHSV glycoprotein interacts with fish cell integrins, potentially triggering type I interferon (IFN) responses . This interaction appears to be a critical step in initiating antiviral defense mechanisms.

  • Pattern recognition receptor activation: The glycoprotein likely engages pattern recognition receptors on immune cells, initiating signaling cascades that lead to the expression of antiviral genes.

  • Type I IFN induction: Specific regions of the VHSV glycoprotein (amino acids 280-310 and 340-370) have been mapped as critical for inducing type I IFN responses and upregulating antiviral genes such as mx3, irf3, and vig1 .

  • Cellular immunity activation: In addition to humoral responses (neutralizing antibodies), the glycoprotein appears to activate cell-mediated immune responses, though these mechanisms are less well characterized in fish than in mammals.

  • Surface expression requirements: Research using virus-neutralizing monoclonal antibodies suggests that the expression of glycoprotein on cell surfaces is more important for inducing interferon than viral gpG gene transcripts expressed inside cells .

These molecular interactions have important implications for vaccine design, suggesting that vaccines should preserve these immunostimulatory properties to induce robust protection. Methodologically, studies using techniques such as surface plasmon resonance, co-immunoprecipitation, and knockout models of specific immune components could further elucidate these interaction mechanisms.

What are the cutting-edge approaches for glycoprotein engineering to overcome genotype specificity?

VHSV exhibits considerable genetic diversity, with four main genotypes identified through nucleotide sequence analysis of the N and G genes . This diversity presents challenges for developing broadly protective vaccines. Several innovative approaches are being explored to address genotype specificity:

  • Consensus sequence design: Computational analysis of glycoprotein sequences from multiple genotypes can identify conserved regions for designing consensus antigens with broader cross-protection.

  • Multi-epitope vaccines: Engineering constructs that incorporate protective epitopes from different genotypes into a single recombinant protein. This approach requires precise epitope mapping using techniques such as pepscan analysis, which has already identified key antigenic regions (amino acids 280-310 and 340-370) .

  • Structure-guided design: Using three-dimensional structural information to identify conserved structural elements that might not be apparent from sequence analysis alone. This approach can guide the engineering of stable, cross-protective immunogens.

  • Glycoengineering: Manipulating glycosylation patterns to enhance immunogenicity while maintaining cross-protective potential. Research has demonstrated that glycosylation is crucial for inducing neutralizing antibody responses in rhabdovirus glycoproteins .

  • Prime-boost strategies: Combining different vaccine modalities (e.g., DNA vaccine prime followed by recombinant protein boost) to broaden immune responses against multiple epitopes.

Implementation of these approaches requires advanced molecular biology techniques, structural biology methods, immunological assays to validate cross-protection, and challenge studies with diverse VHSV isolates representing different genotypes.

What are the most sensitive detection methods for evaluating recombinant VHSV glycoprotein expression?

Accurate detection and quantification of recombinant VHSV glycoprotein is essential for both research and vaccine development. Several complementary methodologies offer varying advantages:

Immunological methods:

  • Western blot/immunoblotting: Provides information on protein size and integrity using VHSV G-specific monoclonal antibodies (MAbs) such as A17 .

  • ELISA: Enables quantitative analysis of recombinant protein expression and can assess binding to neutralizing antibodies.

  • Immunofluorescence: Allows visualization of protein localization in expressing cells, confirming surface expression which is critical for immunogenicity .

Molecular methods:

  • RT-PCR: Detection of glycoprotein gene expression at the RNA level using primers such as VG1-VGR for VHSV G gene .

  • Real-time RT-PCR: Provides quantitative assessment of gene expression levels. TaqMan-based assays targeting the N-gene have been developed with high sensitivity for detection of all VHSV genotypes .

Functional assays:

  • Syncytia formation assay: Evaluates the membrane fusion activity of recombinant glycoprotein under controlled pH conditions. Properly folded VHSV G protein induces cell-cell fusion at specific pH thresholds (pH <6.2) .

  • Virus neutralization assay: Confirms that the recombinant protein induces functionally relevant antibodies when used for immunization.

For comprehensive characterization, researchers should employ multiple complementary methods. For example, combining western blot analysis to confirm protein size with immunofluorescence to verify surface localization and functional assays to assess biological activity provides a more complete profile of the recombinant glycoprotein.

How should researchers design challenge studies to evaluate recombinant VHSV glycoprotein vaccine efficacy?

Designing robust challenge studies for VHSV vaccine evaluation requires careful consideration of multiple parameters to ensure reliable, reproducible, and relevant results:

Study design components:

  • Control groups: Must include both negative controls (unvaccinated) and positive controls (vaccinated with established vaccines, if available). Recommended control groups include:

    • Unvaccinated fish

    • Fish vaccinated with inactivated VHSV

    • Fish vaccinated with attenuated VHSV (where approved)

    • Mock-vaccinated fish (adjuvant only)

  • Sample size determination: Power analysis should be conducted to determine appropriate sample sizes based on expected mortality rates and desired statistical power. Typically, 30-60 fish per group provides adequate statistical power.

  • Challenge method selection:

    • Intraperitoneal injection: Provides consistent results but doesn't mimic natural infection

    • Immersion challenge: More natural but requires higher viral doses

    • Cohabitation: Most natural but introduces variability

  • Virus strain selection: Challenge strains should be relevant to the target population and ideally represent the predominant genotype in the region where the vaccine will be used. Cross-protection studies should include representatives of different genotypes.

  • Environmental parameters:

    • Water temperature significantly affects disease progression and should be controlled

    • Water quality parameters must be monitored throughout the study

    • Fish density and stress factors should be standardized

Assessment parameters:

  • Cumulative mortality (primary endpoint)

  • Relative percent survival (RPS)

  • Viral load in tissues (quantitative PCR)

  • Neutralizing antibody titers

  • Expression of immune-related genes (e.g., mx, irf, vig1)

  • Histopathological evaluation

Statistical analysis:

  • Survival analysis using Kaplan-Meier curves and log-rank tests

  • Comparison of relative percent survival between groups

  • ANOVA for comparing continuous variables (antibody titers, viral loads)

Following standardized protocols enhances comparability between studies and facilitates regulatory approval processes for new vaccine candidates.

What are the critical quality attributes for recombinant VHSV glycoprotein production systems?

Ensuring consistent quality of recombinant VHSV glycoprotein requires monitoring and controlling several critical attributes throughout the production process:

Protein-related attributes:

  • Purity: Typically assessed by SDS-PAGE and should exceed 90% for vaccine applications. Contaminants could affect safety and efficacy.

  • Identity: Confirmed through western blot with specific antibodies like MAb A17 or through mass spectrometry .

  • Glycosylation pattern: Characterized by glycan analysis techniques, as glycosylation significantly impacts immunogenicity. Research indicates that glycosylation is crucial for inducing neutralizing antibody responses .

  • Conformational integrity: Assessed through binding to conformation-dependent neutralizing antibodies such as L7 and C10, which confer passive protection in fish .

  • Functional activity: Evaluated through membrane fusion assays, as the recombinant protein should retain pH-dependent fusion activity similar to native VHSV G protein .

Process-related attributes:

  • Expression yield: Typically measured in mg protein per liter of culture or per gram of biomass.

  • Batch-to-batch consistency: Variation between production batches should be minimized and characterized.

  • Host cell protein content: Must be controlled and reduced through purification processes.

  • Endotoxin levels: Must be below acceptable limits for biological products.

  • Stability during storage: Shelf-life studies under various conditions are essential.

Methodological approaches for monitoring:

  • Analytical techniques: SEC-HPLC, SDS-PAGE, western blot, ELISA, mass spectrometry

  • Functional assays: Membrane fusion assays, antibody binding studies

  • Biological activity tests: Immunization-challenge studies in small scale

Regulatory compliance for veterinary vaccines requires documentation of these attributes and establishment of acceptable ranges for each parameter to ensure consistent product quality.

How can researchers optimize codon usage for improved recombinant VHSV glycoprotein expression?

Codon optimization represents a powerful strategy for enhancing recombinant VHSV glycoprotein expression in heterologous systems. The methodological approach involves several key considerations:

  • Host-specific codon bias analysis: Different expression systems (insect cells, mammalian cells, yeast) have distinct codon usage preferences. Researchers should analyze the codon usage frequency in the target expression system and compare it with the native VHSV G gene sequence.

  • Optimization algorithms: Several bioinformatic tools can optimize codons while maintaining the amino acid sequence:

    • Gene Designer

    • OPTIMIZER

    • JCat (Java Codon Adaptation Tool)

    • Codon Optimization On-Line (COOL)

  • Parameters to consider during optimization:

    • Codon Adaptation Index (CAI): Higher values indicate better adaptation to host preferences

    • GC content: Adjusted to optimal range for the expression system

    • mRNA secondary structure: Eliminate strong RNA secondary structures near the start codon

    • Cryptic splice sites: Remove potential splice sites in eukaryotic systems

    • Repetitive sequences: Minimize repetitive elements that may cause recombination

  • Experimental validation approaches:

    • Comparative expression studies between native and optimized sequences

    • Quantitative RT-PCR to assess transcript levels

    • Pulse-chase experiments to evaluate protein synthesis rates

    • Western blot and ELISA for protein quantification

The table below illustrates potential improvements through codon optimization based on research with similar viral glycoproteins:

ParameterNative SequenceOptimized for Insect CellsOptimized for Mammalian Cells
CAI value0.65-0.750.85-0.950.80-0.90
Expression yieldBaseline2-4× increase1.5-3× increase
mRNA stabilityVariableEnhancedEnhanced
Time to maximum expressionStandardDecreasedDecreased

While the search results don't provide specific data on codon optimization for VHSV glycoprotein, successful expression in insect cells has been demonstrated , suggesting that further optimization could enhance yields for large-scale production.

What emerging technologies could revolutionize recombinant VHSV glycoprotein vaccine development?

Several cutting-edge technologies show promise for transforming VHSV vaccine research and development:

  • mRNA vaccine platforms: Building on recent success with human vaccines, mRNA encoding VHSV glycoprotein could provide advantages including rapid production, strong immune responses, and the ability to update vaccines quickly to address emerging strains.

  • Nanoparticle delivery systems: Self-assembling protein nanoparticles displaying multiple copies of VHSV glycoprotein epitopes in defined orientations could enhance immunogenicity while facilitating mucosal delivery for immersion vaccination, potentially overcoming current limitations .

  • CRISPR-based viral vector engineering: Advanced genome editing enables precise modification of VHSV genomes to create optimized live attenuated vaccines with improved safety profiles. Research has already demonstrated successful rearrangement of the VHSV genome and insertion of foreign antigens .

  • Computational immunology and structural vaccinology: Integrating artificial intelligence with structural biology could identify conserved, immunogenic epitopes across different VHSV genotypes for designing broadly protective immunogens.

  • Plant-based expression systems: Exploring plant bioreactors for cost-effective, scalable production of recombinant VHSV glycoprotein could address production cost challenges, particularly important for aquaculture vaccines.

  • Edible vaccines: Incorporation of recombinant VHSV glycoprotein into fish feed through plant or microbial expression systems could revolutionize administration methods, eliminating handling stress and reducing labor costs.

Methodologically, these approaches require interdisciplinary collaboration between molecular biologists, immunologists, computational scientists, and aquaculture specialists. Proof-of-concept studies, optimization of delivery methods, and comparative challenge studies will be essential to evaluate these emerging technologies against conventional approaches.

How might recombinant VHSV glycoprotein research inform vaccine strategies for other aquatic viruses?

Research on recombinant VHSV glycoprotein offers valuable insights and methodological approaches that can be translated to vaccine development for other important aquatic viruses:

  • Cross-family application of expression systems: The successful baculovirus-insect cell expression system demonstrated for VHSV glycoprotein provides a methodological framework adaptable to glycoproteins from other enveloped fish viruses, such as infectious hematopoietic necrosis virus (IHNV), spring viremia of carp virus (SVCV), and infectious salmon anemia virus (ISAV).

  • Bivalent/multivalent vaccine design principles: The engineering approach used to create recombinant VHSV expressing nervous necrosis virus (NNV) antigens establishes a blueprint for developing multivalent vaccines addressing multiple pathogens, a significant advantage in aquaculture where co-infections are common.

  • Immunological insights: Understanding how VHSV glycoprotein interacts with fish immune systems, particularly the role of specific regions (amino acids 280-310 and 340-370) in triggering type I interferon responses , informs rational design of immunogens for other viruses.

  • Delivery system optimization: Lessons learned from the success of injectable recombinant glycoprotein vaccines versus the limitations of immersion delivery provide crucial guidance for developing administration strategies for other aquatic viral vaccines.

  • Reverse genetics applications: The methods developed for VHSV genome manipulation can be adapted for other RNA viruses affecting aquaculture, enabling rational attenuation and antigen incorporation strategies.

For methodological transfer, researchers should consider:

  • Comparative genomic analysis to identify analogous immunogenic proteins in target pathogens

  • Structural modeling to predict epitope accessibility and conservation

  • Adaptation of expression and purification protocols with virus-specific modifications

  • Standardized immunological assessment frameworks to enable cross-study comparisons

These translational approaches can accelerate vaccine development for emerging aquatic pathogens by building on the established knowledge base from VHSV glycoprotein research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.