Recombinant Virulence sensor histidine kinase PhoQ (phoQ)

Shipped with Ice Packs
In Stock

Description

Introduction

The PhoP/PhoQ two-component system, present in various gammaproteobacterial species, is composed of the DNA-binding protein PhoP and the sensor PhoQ . This system plays a crucial role in governing virulence, magnesium homeostasis, and resistance to antimicrobial agents, including acidic pH and cationic antimicrobial peptides . PhoQ modulates the phosphorylation status of PhoP in response to cytoplasmic and extracytoplasmic signals. Upon encountering activating signals, PhoQ autophosphorylates at a conserved histidine residue using adenosine triphosphate (ATP) . The phosphate group is then transferred to a conserved aspartate residue within the N-terminal domain of PhoP . PhoQ also exhibits phosphatase activity toward phosphorylated PhoP (PhoP-P) .

Function and Mechanism

PhoQ functions as a membrane-associated protein kinase that undergoes autophosphorylation in the presence of low periplasmic magnesium concentrations . The PhoP/PhoQ system was the first discovered signal transduction system responding to magnesium as a primary signal . It has also provided insights into the dynamic nature of lipopolysaccharide (LPS) in response to environmental conditions experienced by Salmonella Typhimurium within a mammalian host .

Salmonella PhoQ is a histidine kinase that contains a periplasmic sensor domain (PD) and promotes virulence by detecting the macrophage phagosome . Within the macrophage phagosome and other mammalian host sites, Salmonellae encounter changing environments with various antimicrobial factors, necessitating tightly regulated resistance mechanisms via sensors like PhoQ for successful infection .

Role in Virulence

The PhoP/PhoQ system significantly impacts bacterial virulence. In Pseudomonas aeruginosa, the PhoPQ system contributes to virulence and polymyxin resistance . Mutation of phoQ in P. aeruginosa results in a phenotype similar to less virulent but more inflammatory clinical strains isolated from chronic-stage cystic fibrosis lung infections . A phoQ mutant cocultured on epithelial cells produces less secreted protease and lipase and demonstrates reduced cytotoxicity toward epithelial cells . Mutation in phoQ also leads to alterations in lipid A and increased inflammatory LPS .

P. aeruginosa GacS, a histidine kinase, shares partial functional overlaps with PhoQ . A knockout mutation in gacS significantly reduces virulence in mice, demonstrating its importance in virulence-related characteristics .

Regulation and Environmental Response

PhoQ responds to environmental signals such as acidic pH and divalent cation concentrations . Studies show that PhoQ PD residues and structural features undergo conformational changes during pH titration . Acidic pH or divalent cation limitation promotes a change in α4 and α5 from a stable to a dynamic state. This flexibility may destabilize divalent cation salt-bridges between the inner membrane and acidic patch, promoting a loss of divalent cation-mediated repression .

PhoQ in E. coli

In extraintestinal E. coli (ExPEC), the PhoP/PhoQ system, along with CloV plasmids, can enhance survival and replication within macrophages .

Inhibitors of PhoQ

Targeting virulence pathways, such as the MvfR-regulated quorum sensing (QS) virulence pathway in P. aeruginosa, can identify compounds that inhibit infection without affecting bacterial growth . Certain compounds with a benzamide-benzimidazole backbone bind to the global virulence QS transcriptional regulator, MvfR (PqsR), inhibiting the MvfR regulon and reducing the formation of antibiotic-tolerant persister cells .

Data Table

PA no.GeneDescriptionMean fold change (±SEM) in ratio of adhered vs unadhered a
Wild typephoQ b
PA1178oprHOuter membrane protein in operon with phoP-phoQ5,200 ± 950
PA1179phoPTwo-component response regulator116 ± 43
PA4777pmrBTwo-component response regulator3.7 ± 1.6
PA3552arnBAminoarabinose synthesis; lipid A modification995 ± 223
PA4661pagLLipid A 3-O-deacylase3.9 ± 1.0
PA1092fliCFlagellin subunit5 ± 2.1
PA2862lipALipase4.3 ± 1.8
PA1249aprAAlkaline protease2.6 ± 0.8
PA3841exoSType 3 secreted effector, exoenzyme S1.36 ± 0.3
PA4626pilBType IV pilin biogenesis protein1.5 ± 0.3
PA0026plcBPhospholipase C1.2 ± 0.2
PA1148toxAExotoxin A1.1 ± 0.7
PA1430lasRTranscriptional regulator1.9 ± 0.3

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
phoQ; STY1270; t1690; Virulence sensor histidine kinase PhoQ; Sensor histidine protein kinase/phosphatase PhoQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Salmonella typhi
Target Names
phoQ
Target Protein Sequence
MNKFARHFLPLSLRVRFLLATAGVVLVLSLAYGIVALVGYSVSFDKTTFRLLRGESNLFY TLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFH EIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATTRMPQLTIVVVDT IPIELKRSYMVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIEALAREVRELEDHHREMLN PETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSV SKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKG VNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPG IPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQ HPTQKEE
Uniprot No.

Target Background

Function
PhoQ is a member of the two-component PhoP/PhoQ regulatory system in bacteria. This system controls the expression of genes involved in virulence and resistance to antimicrobial peptides produced by the host's immune system. Under conditions of low periplasmic Mg²⁺, PhoQ acts as a membrane-bound histidine kinase, autophosphorylating and transferring the phosphate group to PhoP. This activates PhoP-activated genes (PAGs) and represses PhoP-repressed genes (PRGs). Conversely, under high periplasmic Mg²⁺ conditions, PhoQ functions as a phosphatase, dephosphorylating PhoP, which represses PAGs and may induce the expression of some PRGs. PhoQ plays a crucial role in Salmonella's intracellular survival within macrophages and enhances resistance to bile in the human intestinal tract.
Gene References Into Functions
  1. Groisman EA. The Pleiotropic Two-Component Regulatory System PhoP-PhoQ. In: Curtiss R, editor. Salmonella. Caister Academic Press; 2006. p. 113-125. PMID: 15948951
Database Links

KEGG: stt:t1690

STRING: 220341.STY1270

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the PhoP/PhoQ two-component system and how does it function in bacterial signaling?

The PhoP/PhoQ system is a broadly conserved two-component signal-transduction system widespread in bacteria, consisting of the transmembrane histidine kinase sensor PhoQ and the cytoplasmic response regulator PhoP. This system functions through a phosphorylation cascade whereby PhoQ detects environmental signals and undergoes autophosphorylation. The phosphoryl group is then transferred from PhoQ to PhoP, activating PhoP to regulate the expression of downstream genes involved in virulence and stress responses .

In its basic catalytic cycle, PhoQ exhibits three primary activities:

  • Autokinase activity in the presence of Mg²⁺-ATP

  • Phosphotransferase activity (transferring the phosphoryl group to PhoP)

  • Phosphatase activity (dephosphorylating phospho-PhoP), which is stimulated by ADP

The system is crucial for bacterial adaptation to environmental stresses and for pathogenic bacteria, it coordinates virulence mechanisms in response to host conditions .

Which environmental signals activate the PhoQ sensor kinase?

PhoQ responds to multiple environmental signals that are often encountered during host infection:

  • Low Mg²⁺ concentrations: Limited extracellular Mg²⁺ activates the PhoP/PhoQ phosphorylation cascade, while high Mg²⁺ concentrations stimulate dephosphorylation of PhoP

  • Acidic pH: PhoQ is activated under acidic conditions typically found in the macrophage phagosome

  • Cationic antimicrobial peptides (CAMPs): Peptides such as LL-37 and HBD2 activate PhoQ, representing host immune defenses that bacteria must overcome

  • Macrophage phagosomal environment: PhoQ detects conditions within the phagosome, promoting bacterial survival within these immune cells

Interestingly, acidic pH and CAMPs additively activate PhoQ through distinct sensing mechanisms, suggesting multiple detection pathways within the PhoQ periplasmic domain .

How does the PhoP/PhoQ system contribute to bacterial virulence across different species?

The PhoP/PhoQ system regulates virulence in multiple pathogenic bacteria, though its specific mechanisms vary across species:

  • In Salmonella typhimurium: The system coordinates adaptation to low Mg²⁺ environments and regulates genes necessary for survival within macrophages and resistance to antimicrobial peptides

  • In Shigella flexneri: PhoP/PhoQ regulates virulence by controlling the expression of icsA, a critical virulence factor required for Shigella pathogenesis. Deletion of phoPQ causes decreased inflammatory response, reduced invasiveness, and increased sensitivity to polymorphonuclear leucocytes (PMNs)

  • In Extraintestinal Pathogenic E. coli (ExPEC): The system facilitates bacterial survival and replication within macrophages and mediates resistance to cationic antimicrobial peptides through multiple regulatory pathways

  • In other pathogens: The system has been shown to regulate virulence in Yersinia pestis, Mycobacterium tuberculosis, Neisseria, Erwinia, Pseudomonas, and Serratia

The PhoP regulon varies significantly between bacterial species. Comparative studies between Salmonella and E. coli found only a limited number of genes in common between their PhoP regulons, highlighting the evolutionary adaptation of this system to different pathogenic lifestyles .

How can PhoQ be purified and functionally reconstituted for in vitro studies?

Purification and reconstitution of PhoQ involves several key methodological steps:

  • Protein expression: Create a PhoQ variant with a C-terminal His tag (PhoQ₍ₕᵢₛ₎) for easier purification

  • Purification process:

    • Isolate bacterial membranes containing the expressed PhoQ₍ₕᵢₛ₎

    • Solubilize the membrane protein using appropriate detergents

    • Perform affinity chromatography using the His tag to isolate PhoQ₍ₕᵢₛ₎

    • Verify protein purity using SDS-PAGE and/or Western blotting

  • Liposome reconstitution:

    • Prepare E. coli liposomes using extracted phospholipids

    • Mix purified PhoQ₍ₕᵢₛ₎ with liposomes

    • Remove detergent gradually to allow protein incorporation into liposomes

    • Ensure unidirectional orientation with the sensory domain facing the lumen and the catalytic domain facing the extraluminal environment

  • Functional verification:

    • Test autokinase activity by incubating reconstituted PhoQ₍ₕᵢₛ₎ with Mg²⁺-ATP

    • Verify phosphotransfer to purified PhoP

    • Measure dephosphorylation of phospho-PhoP and its stimulation by extraluminal ADP

This reconstitution system provides a valuable tool for studying PhoQ catalytic activities and signal sensing mechanisms in a controlled environment with defined components.

What methods are effective for analyzing PhoQ conformational changes in response to environmental signals?

Several experimental approaches can be employed to analyze conformational changes in PhoQ:

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Heteronuclear single quantum coherence (HSQC) experiments can identify residues that experience pH-dependent changes

    • This approach has revealed that acidic pH induces conformational flexibility in α-helices 4 and 5 of the PhoQ periplasmic domain

  • Disulfide bond engineering:

    • Creating disulfide bonds between specific residues (e.g., W104C and A128C) can restrain conformational flexibility in regions of interest

    • Such modifications can help investigate the importance of specific conformational changes for signal sensing

  • Random mutagenesis:

    • Randomly mutagenize the periplasmic domain to identify mutations that activate PhoQ in the presence of repressing concentrations of divalent cations

    • This approach can identify residues important for signal transduction

  • Functional studies with mutant PhoQ variants:

    • Create PhoQ variants that respond selectively to certain signals (e.g., responsive to CAMPs but not to acidic pH)

    • Use these variants to determine the contribution of specific stimuli to bacterial virulence in animal models

These methodologies, especially when used in combination, provide powerful tools for understanding the structural basis of signal detection and transmission by PhoQ.

How can researchers identify and validate PhoP-regulated genes in different bacterial species?

Identification and validation of PhoP-regulated genes require multiple complementary approaches:

  • Transcriptional profiling:

    • Microarray analysis comparing wild-type and phoPQ deletion mutants to identify differentially expressed genes

    • RNA-seq for more comprehensive and sensitive transcriptome analysis

  • Electrophoretic Mobility Shift Assays (EMSAs):

    • Test direct binding of purified PhoP to promoter regions of candidate genes

    • This confirms direct regulation rather than secondary effects

  • β-galactosidase reporter assays:

    • Create transcriptional fusions between candidate promoters and the lacZ gene

    • Measure β-galactosidase activity to quantify promoter activity in different genetic backgrounds and conditions

  • Identification of PhoP binding motifs:

    • Search for conserved PhoP binding motifs in promoter regions of candidate genes

    • Verify the functionality of these motifs through site-directed mutagenesis

  • Validation through complementation:

    • Restore wild-type phenotypes by expressing PhoP/PhoQ in deletion mutants

    • This confirms that observed effects are specifically due to the absence of PhoP/PhoQ

Using this multi-faceted approach, researchers identified 11 PhoP-regulated genes or operons in Shigella, including icsA, a well-known virulence factor that was validated to be regulated by PhoPQ for the first time .

How does PhoQ distinguish between different environmental signals at the molecular level?

PhoQ employs distinct molecular mechanisms to sense different environmental signals:

  • Mg²⁺ sensing:

    • The periplasmic domain of PhoQ contains an acidic patch that binds divalent cations

    • Binding of Mg²⁺ to this acidic patch creates salt bridges with the inner membrane, stabilizing PhoQ in an inactive conformation

    • Low Mg²⁺ concentrations disrupt these interactions, leading to PhoQ activation

  • CAMP sensing:

    • Cationic antimicrobial peptides directly compete with divalent cations for binding sites within the PhoQ periplasmic domain acidic patch

    • CAMPs disrupt the salt bridges between PhoQ and the inner membrane, triggering activation

  • pH sensing:

    • Acidic pH sensing involves conformational changes in a network of residues surrounding H157 within the α/β-core of the periplasmic domain

    • NMR studies reveal that acidic pH induces structural flexibility in α-helices 4 and 5

    • This mechanism is distinct from CAMP sensing

These different sensing mechanisms allow PhoQ to integrate multiple environmental signals. Interestingly, acidic pH and CAMP additively activate PhoQ, supporting the existence of distinct sensing mechanisms for these stimuli .

What is the role of feedback inhibition in the PhoQ/PhoP signaling system?

Feedback inhibition is an important regulatory feature of the PhoQ/PhoP system:

  • MgrB-mediated feedback:

    • MgrB is a small membrane peptide whose expression is directly regulated by PhoP

    • It provides negative feedback to the PhoQ/PhoP system by inhibiting PhoQ activity

    • This represents a striking example of a small, easily-overlooked open reading frame playing a critical role in regulating a broadly conserved signal transduction pathway

  • Functional significance:

    • As the PhoQ/PhoP system functions as a critical stress response circuit for survival under conditions of low magnesium or in the presence of antimicrobial peptides, negative feedback is essential for:

      • Preventing overactivation of the system

      • Fine-tuning the response to environmental signals

      • Allowing rapid adaptation to changing conditions

      • Maintaining homeostasis in bacterial physiology

  • Regulatory mechanism:

    • MgrB appears to interact directly with PhoQ to modulate its activity

    • This interaction likely affects the autophosphorylation or phosphatase activity of PhoQ

The existence of this feedback mechanism highlights the sophisticated regulatory control of the PhoQ/PhoP system and its importance in bacterial stress responses.

How do mutations in the PhoQ sensor domain affect signal detection and bacterial virulence?

Mutations in the PhoQ sensor domain can have significant impacts on signal detection and virulence:

  • Engineered disulfide bond between W104C and A128C:

    • This modification restrains conformational flexibility in α-helices 4 and 5

    • PhoQ W104C-A128C remains responsive to CAMPs but is inhibited for activation by acidic pH and divalent cation limitation

    • Interestingly, Salmonella enterica Typhimurium expressing this PhoQ variant remains virulent in mice, indicating that acidic pH and divalent cation sensing by PhoQ are dispensable for virulence

  • Activating mutations:

    • Random mutagenesis has identified mutations that activate PhoQ even in the presence of repressing concentrations of divalent cations

    • Many of these mutations localize to regions that overlap with pH-sensitive residues identified by NMR, forming an interconnected network spanning α4 and α5 and the α/β-core

  • Functional consequences:

    • Mutations affecting specific sensing mechanisms allow dissection of the contribution of individual signals to bacterial virulence

    • This approach revealed that CAMP sensing is critical for virulence while acidic pH and divalent cation sensing are dispensable in certain contexts

These findings highlight the complex relationship between PhoQ structure, signal sensing, and virulence, and demonstrate the value of structure-guided mutagenesis in understanding bacterial pathogenesis.

How does the PhoP/PhoQ system contribute to Shigella flexneri virulence?

The PhoP/PhoQ system plays multiple roles in Shigella flexneri virulence:

  • Regulation of virulence factors:

    • PhoPQ directly regulates icsA (also known as virG), a critical virulence factor required for Shigella pathogenesis

    • IcsA is essential for actin-based motility and cell-to-cell spread of Shigella

    • A highly conserved PhoP binding motif is found in the promoter region of icsA

  • Impact on invasion and cellular infection:

    • Deletion of phoPQ significantly decreases Shigella's ability to invade HeLa cells and Caco-2 cells

    • Cells infected with ΔphoPQ mutants show no obvious membrane ruffling, a hallmark of Shigella invasion

    • These findings indicate that PhoPQ modulates Shigella virulence in an icsA-dependent manner

  • In vivo virulence effects:

    • In the guinea pig keratoconjunctivitis model (Sereny test), guinea pigs infected with ΔphoPQ display only slight conjunctival inflammation

    • Pathological examination reveals fewer pathologic changes in tissues infected with ΔphoPQ compared to wild-type

    • These results demonstrate the importance of PhoPQ for Shigella virulence in vivo

  • Stress response regulation:

    • PhoPQ allows Shigella to tolerate low environmental Mg²⁺, acidic pH, and the presence of polymyxin B

    • These environmental input signals promote the expression of PhoPQ, creating a positive feedback loop that enhances survival under stress conditions

These findings demonstrate that the PhoPQ system is a central regulator of both stress responses and virulence in Shigella flexneri.

What role does PhoQ play in bacterial resistance to host antimicrobial peptides?

PhoQ plays a crucial role in bacterial resistance to host antimicrobial peptides through multiple mechanisms:

  • Sensing and response to CAMPs:

    • PhoQ directly senses cationic antimicrobial peptides (CAMPs) such as LL-37 and HBD2

    • CAMPs compete with divalent cations for binding to the acidic patch in the PhoQ periplasmic domain, activating the PhoQ/PhoP system

  • Regulation of resistance genes:

    • In Extraintestinal Pathogenic E. coli (ExPEC), PhoP/PhoQ regulates genes that mediate resistance to CAMPs:

      • Mig-14p: Contributes to CAMP resistance; overexpression significantly increases survival when exposed to LL-37 and HBD2

      • OmpTp: Deletion mutants show increased susceptibility to both LL-37 (32.5% survival) and HBD2 (42.5% survival)

  • Lipopolysaccharide modification:

    • PhoQ/PhoP can regulate bacteria to activate lipopolysaccharide (LPS) modifications

    • Modified LPS has increased resistance to CAMPs due to altered surface charge and reduced binding of these cationic peptides

  • Multiple regulatory pathways:

    • PhoP/PhoQ can mediate resistance to CAMPs through multiple regulatory pathways

    • Deletion of PhoP in ExPEC results in dramatically increased susceptibility to LL-37 (9.8% survival) and HBD2 (6.9% survival)

    • This effect is much stronger than deleting individual resistance genes, suggesting PhoP regulates multiple defense mechanisms

This multifaceted approach to CAMP resistance highlights the importance of the PhoQ/PhoP system in bacterial evasion of host innate immunity.

How do different bacterial species adapt the PhoP/PhoQ system for their specific virulence mechanisms?

The PhoP/PhoQ system has been adapted by different bacterial species to regulate species-specific virulence mechanisms:

This evolutionary plasticity of the PhoP/PhoQ system has allowed various bacterial pathogens to adapt this conserved signaling pathway to their unique virulence strategies.

What is the significance of the finding that acidic pH and divalent cation sensing by PhoQ are dispensable for Salmonella virulence?

The discovery that acidic pH and divalent cation sensing by PhoQ are dispensable for Salmonella virulence represents a significant advance in our understanding:

  • Experimental approach:

    • Researchers engineered a disulfide bond between W104C and A128C in the PhoQ periplasmic domain

    • This modification restrains conformational flexibility in α-helices 4 and 5, inhibiting activation by acidic pH and divalent cation limitation while maintaining responsiveness to CAMPs

    • Salmonella expressing this PhoQ variant retained virulence in mice

  • Conceptual significance:

    • Prior to this study, it was unclear which environmental signals were actually sensed by Salmonella to promote PhoQ-mediated virulence

    • The findings indicate that CAMP sensing, rather than acidic pH or divalent cation sensing, is the critical environmental signal for PhoQ-mediated virulence in Salmonella

  • Implications for signal integration:

    • These results suggest a hierarchy of importance among the various signals detected by PhoQ

    • They also indicate that the multiple sensing capabilities of PhoQ may provide redundancy or context-dependent advantages rather than all being essential for virulence

  • Future research directions:

    • Investigation of the specific CAMP sensing mechanisms that are essential for virulence

    • Exploration of potential therapeutic approaches targeting CAMP sensing by PhoQ

    • Analysis of whether this hierarchy of signal importance is conserved across different bacterial species

This discovery has fundamentally changed our understanding of the environmental cues that drive bacterial virulence and highlights the power of structure-guided mutagenesis in dissecting complex signaling systems.

How might targeting the PhoQ/PhoP system contribute to novel antimicrobial strategies?

The PhoQ/PhoP system presents several promising avenues for antimicrobial development:

  • Strategic advantages of targeting PhoQ/PhoP:

    • The system is widely conserved among pathogenic bacteria but absent in humans

    • It regulates multiple virulence mechanisms and stress responses

    • Inhibiting this system could potentially reduce virulence without directly killing bacteria, potentially reducing selective pressure for resistance

  • Potential targeting approaches:

    • Small molecule inhibitors of PhoQ sensor domain that block signal detection

    • Compounds that mimic MgrB to exploit natural feedback inhibition mechanisms

    • Peptides that interfere with PhoQ-PhoP phosphotransfer

    • Molecules that lock PhoQ in an inactive conformation

  • Experimental evidence:

    • Previous studies have shown that inhibitors of PhoQ reduced the virulence of Shigella flexneri

    • This supports the concept that targeting this system can attenuate bacterial virulence

  • Combination therapy potential:

    • PhoQ/PhoP inhibitors could be used in combination with traditional antibiotics

    • This approach might enhance antibiotic efficacy by impairing bacterial stress responses

    • It could also prevent the induction of virulence factors during antibiotic treatment

  • Challenges and considerations:

    • Development of inhibitors that are specific to pathogenic bacteria while sparing beneficial microbiota

    • Potential for bacteria to develop resistance through mutations in the PhoQ/PhoP system

    • Need for inhibitors that are effective against the diverse PhoQ/PhoP systems in different bacterial species

Targeting the PhoQ/PhoP system represents a promising "anti-virulence" approach to antimicrobial development that could complement traditional antibiotic strategies.

What are the current technical challenges in studying PhoQ signal transduction mechanisms?

Several technical challenges persist in the comprehensive study of PhoQ signal transduction:

  • Structural challenges:

    • Obtaining high-resolution structures of full-length PhoQ in different signaling states

    • Capturing transient conformational changes during signal transmission from periplasmic to cytoplasmic domains

    • Understanding the structural basis of PhoQ-PhoP interaction during phosphotransfer

  • Reconstitution limitations:

    • Current liposome reconstitution systems may not fully recapitulate the native membrane environment

    • Challenges in controlling the precise orientation of reconstituted PhoQ

    • Difficulty in simultaneously applying multiple signals (e.g., acidic pH, low Mg²⁺, and CAMPs) in reconstituted systems

  • In vivo signal detection:

    • Limited tools for real-time monitoring of PhoQ activation states in living bacteria

    • Difficulty in precisely defining the environmental conditions experienced by bacteria within host tissues

    • Challenges in distinguishing direct PhoQ sensing from indirect effects in complex environments

  • Species-specific variations:

    • The diversity of PhoP regulons across species complicates comparative studies

    • Different experimental systems may be required for each bacterial species

    • Findings from one species may not be generalizable to others

  • Signal integration:

    • Understanding how PhoQ integrates multiple simultaneous signals remains challenging

    • The hierarchy and potential synergism or antagonism between different signals needs further clarification

    • The temporal dynamics of PhoQ response to changing environmental conditions requires sophisticated experimental approaches

Addressing these challenges will require innovative experimental approaches and the integration of structural biology, biochemistry, genetics, and advanced imaging techniques.

What are the key considerations when designing experiments to study PhoQ function in different bacterial species?

When designing experiments to study PhoQ function across bacterial species, researchers should consider:

  • Genetic tools and background strains:

    • Ensure appropriate genetic manipulation tools are available for the species of interest

    • Consider the genetic background of strains (wild-type vs. laboratory-adapted)

    • Account for potential polar effects when creating phoPQ deletion mutants

  • Species-specific regulation:

    • Recognize that PhoP regulons vary significantly between species

    • Don't assume regulatory relationships identified in one species apply to others

    • Perform comparative genomic analyses to identify potential species-specific PhoP targets

  • Experimental conditions:

    • Carefully control Mg²⁺ concentrations, pH, and presence of CAMPs

    • Consider the growth phase of bacteria, as PhoQ/PhoP regulation may be growth-phase dependent

    • Design experiments that mimic relevant host environments (e.g., macrophage phagosome conditions)

  • Complementation controls:

    • Include genetic complementation of deletion mutants to confirm phenotypes

    • Consider using both plasmid-based and chromosomal complementation approaches

    • Verify that complemented strains express physiologically relevant levels of PhoP/PhoQ

  • In vivo models:

    • Select animal models appropriate for the bacterial species and disease being studied

    • Consider ethical approvals and regulations (e.g., IACUC approval)

    • Design experiments that can distinguish between different aspects of virulence (invasion, replication, dissemination)

  • Signal-specific mutations:

    • Consider using PhoQ variants that respond selectively to certain signals

    • This approach can help determine the contribution of specific stimuli to virulence

    • Engineer mutations based on structural knowledge of the PhoQ sensory domain

These considerations will help ensure robust and reproducible research on PhoQ function across different bacterial species.

How can researchers effectively analyze and interpret contradictory findings about PhoQ function in the literature?

Researchers facing contradictory findings about PhoQ function should consider these methodological approaches:

  • Experimental context analysis:

    • Examine differences in bacterial strains used (laboratory vs. clinical isolates)

    • Compare growth conditions, media composition, and experimental timeframes

    • Analyze differences in genetic manipulation techniques and potential polar effects

    • Consider the specific host or in vitro models employed

  • Signal-specific effects:

    • Determine which PhoQ-activating signals were present in different studies

    • Consider that PhoQ responds differently to various signals (Mg²⁺, pH, CAMPs)

    • Evaluate whether engineered PhoQ variants with altered signal sensitivity were used

    • Assess whether studies distinguished between direct and indirect effects on PhoQ

  • Species-specific variations:

    • Consider that findings in one bacterial species may not apply to others

    • Compare the conservation of PhoQ structure and the PhoP regulon across species

    • Evaluate evolutionary adaptations of the PhoQ/PhoP system in different pathogens

  • Technical considerations:

    • Analyze differences in protein purification and reconstitution methods

    • Compare methods used to measure PhoQ activity (phosphorylation assays, reporter systems)

    • Evaluate the sensitivity and specificity of detection methods

  • Integrative analysis:

    • Combine findings from genetic, biochemical, structural, and in vivo approaches

    • Weigh evidence based on methodology robustness and reproducibility

    • Consider whether contradictions represent context-dependent regulation rather than errors

  • Replication studies:

    • Design experiments that directly address contradictions in the literature

    • Include positive and negative controls from previous studies

    • Consider collaborative approaches to resolve contradictions through independent verification

This systematic approach to analyzing contradictory findings can help resolve apparent discrepancies and lead to a more nuanced understanding of PhoQ function.

What bioinformatic approaches are most effective for studying PhoP regulons across bacterial species?

Effective bioinformatic approaches for studying PhoP regulons include:

  • PhoP binding motif identification:

    • Perform position weight matrix (PWM) analyses of known PhoP binding sites

    • Use tools like MEME, FIMO, or similar motif discovery algorithms

    • Search for conserved PhoP binding motifs in promoter regions genome-wide

    • Validate predicted binding sites experimentally through EMSAs or reporter assays

  • Comparative genomic analyses:

    • Compare PhoP regulons across related bacterial species

    • Identify core (conserved) versus accessory (species-specific) components

    • Analyze the evolution of PhoP regulons in the context of bacterial adaptation to different niches

    • Use orthology mapping to track the fate of PhoP-regulated genes during evolution

  • Integration with experimental data:

    • Combine bioinformatic predictions with transcriptomic data (RNA-seq, microarray)

    • Apply network analysis to identify direct versus indirect regulation

    • Use ChIP-seq data (where available) to identify genome-wide PhoP binding sites

    • Integrate with proteomics data to account for post-transcriptional regulation

  • Structural bioinformatics:

    • Model the structure of PhoP DNA-binding domains from different species

    • Predict the impact of sequence variations on DNA-binding specificity

    • Analyze co-evolution between PhoP and its binding sites across species

  • Machine learning approaches:

    • Develop predictive models of PhoP regulation based on known targets

    • Incorporate multiple features including binding site strength, promoter architecture, and genomic context

    • Apply these models to identify novel PhoP-regulated genes across bacterial genomes

  • Database integration:

    • Utilize existing bacterial transcription factor databases

    • Develop specialized databases of PhoP-regulated genes across species

    • Implement tools for cross-species comparison of regulons

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.