Recombinant Virulence sensor protein PhoQ (phoQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
phoQ; SF1148; S1231; Virulence sensor protein PhoQ; Sensor histidine protein kinase/phosphatase PhoQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Shigella flexneri
Target Names
phoQ
Target Protein Sequence
MKKLLRLFFPLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFY TLAQWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFH EIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDT IPVELKSSYMVWSWFIYVLSANLLLVIPLLWVAAWWSLRPIEALAKEVRELEEHNRELLN PATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSV SDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGV NISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGI PLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH SAPKDE
Uniprot No.

Target Background

Function

PhoQ is a member of the two-component PhoP/PhoQ regulatory system, crucial for virulence and adaptation to low Mg2+ environments. Under low periplasmic Mg2+ conditions, PhoQ functions as a membrane-associated kinase, autophosphorylating and subsequently transferring the phosphate to PhoP. This activates the expression of PhoP-activated genes (PAGs) and represses PhoP-repressed genes (PRGs). Conversely, in high periplasmic Mg2+, PhoQ acts as a phosphatase, dephosphorylating phospho-PhoP, repressing PAGs and potentially inducing the expression of some PRGs. PhoQ is essential for resistance to killing by polymorphonuclear leukocytes (PMNs) and their associated cationic antimicrobial peptides (CAMPs).

Database Links

KEGG: sfl:SF1148

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the PhoQ sensing domain and how does it relate to its function?

The PhoQ protein contains a periplasmic sensor domain (PD) that is critical for detecting environmental signals. Research has identified a 146-amino acid polypeptide corresponding to the periplasmic domain that is responsible for sensing environmental conditions . The sensing domain contains multiple structural elements including α-helices and β-sheets that form an interconnected network spanning α4 and α5 and the α/β-core . This structure enables PhoQ to undergo conformational changes in response to environmental stimuli such as divalent cations, acidic pH, and cationic antimicrobial peptides (CAMPs). The PhoQ PD has evolved α4 and α5 as unique pH-responsive structural elements, effectively replacing the ligand-binding site often found in similar locations in other structurally related PDC sensor domains .

How does PhoQ detect and respond to different environmental signals?

PhoQ employs distinct sensing mechanisms for different environmental signals. For divalent cations like Mg2+ and Ca2+, binding sites have been identified within the PhoQ protein . Mg2+ alters the tryptophan intrinsic fluorescence of the periplasmic domain polypeptide, whereas Ba2+, which is unable to modulate transcription of PhoP-regulated genes, does not cause this alteration .

For acidic pH sensing, NMR spectroscopy has revealed that α-helices 4 and 5 undergo significant conformational changes in response to pH shifts . Approximately 42 of 120 assigned residues in the PhoQ PD were affected by transition from pH 6.5 to 3.5, with about 20 affected resonances broadening beyond detection at pH 6.5, consistent with pH-dependent conformational dynamics .

For CAMPs, research indicates they directly compete with divalent cations for binding sites within the PhoQ PD acidic patch, leading to activation by disrupting salt-bridges with the inner membrane . Interestingly, acidic pH and CAMP additively activate PhoQ, suggesting distinct sensing mechanisms for these stimuli .

What spectroscopic methods are most effective for studying conformational changes in PhoQ?

Nuclear Magnetic Resonance (NMR) spectroscopy, particularly Heteronuclear Single Quantum Coherence (HSQC) experiments, has proven highly effective for studying conformational changes in the PhoQ periplasmic domain. By comparing spectra collected at different pH values (e.g., pH 3.5 and pH 6.5), researchers can identify regions in the protein that are sensitive to changes in pH .

When analyzing NMR data for PhoQ, researchers should pay attention to:

  • Resonances that exhibit pH-dependent fast-exchange behavior (consistent with ionization of histidine and acidic residues)

  • Resonances that broaden and disappear from the spectrum (indicative of intermediate-to-slow exchange and conformational changes)

  • Chemical shift perturbations (CSPs > 0.08 ppm) that localize to regions containing ionizable functional groups

In addition to NMR, tryptophan intrinsic fluorescence measurements have been successfully employed to detect binding of divalent cations such as Mg2+ to the PhoQ periplasmic domain .

How can site-directed mutagenesis be utilized to investigate PhoQ sensing mechanisms?

Site-directed mutagenesis has been instrumental in understanding PhoQ sensing mechanisms. The methodological approach involves:

  • Identification of target residues based on structural data, sequence conservation, or random mutagenesis screens

  • Generation of point mutations in the PhoQ gene using standard site-directed mutagenesis protocols or Gibson assembly

  • Expression of mutant proteins and assessment of their function through in vivo reporter assays or in vitro biochemical assays

A particularly informative approach is engineering disulfide bonds to restrict conformational flexibility. For example, researchers engineered a disulfide bond between W104C and A128C in the PhoQ PD that restrains conformational flexibility in α-helices 4 and 5 . This mutant, PhoQ W104C-A128C, is responsive to CAMPs but inhibited for activation by acidic pH and divalent cation limitation, effectively bifurcating the PhoQ signaling capabilities .

Random mutagenesis screens can also identify residues that, when mutated, alter PhoQ activity. For instance, mutations that destabilize hydrophobic packing and hydrogen bonding between the α/β-core and α4 and α5 resulted in loss of PhoQ repression .

How does the PhoQ conformational change propagate to activate the PhoP/PhoQ signaling pathway?

The propagation of conformational changes from the periplasmic sensing domain of PhoQ to the cytoplasmic histidine kinase domain involves a complex series of structural rearrangements. Based on research findings, the model of PhoQ activation involves:

  • Stimulus detection: Environmental signals (acidic pH, limited divalent cations, or CAMPs) are detected by the periplasmic domain

  • Conformational changes: These signals induce specific conformational changes in the periplasmic domain

  • Transmembrane signal propagation: The conformational changes are propagated through the transmembrane domains

  • Kinase activation: The cytoplasmic histidine kinase domain is activated, leading to autophosphorylation

  • Phosphotransfer: The phosphoryl group is transferred to the response regulator PhoP

  • Gene regulation: Phosphorylated PhoP regulates the expression of target genes

A two-state computational model suggests that the PhoQ periplasmic domain experiences broad conformational changes within the periplasmic dimerization interface and acidic patch . In this model, the acidic patch moves away from the membrane in the absence of divalent cations . Restricting movement in α4 and α5 inhibits PhoQ activation by acidic pH and divalent cation limitation, supporting the model that the acidic patch and α4 and α5 must remain dynamic for proper signaling .

What are the distinct binding sites for different cations in PhoQ and how do they affect signaling?

Research has established the presence of distinct binding sites for Mg2+ and Ca2+ in the PhoQ protein . These binding sites have different affinities and effects on PhoQ activity:

  • Mg2+ binding: Mg2+ is more effective than Ca2+ at repressing transcription of PhoP-activated genes in vivo . Mg2+ alters the tryptophan intrinsic fluorescence of the periplasmic domain polypeptide, indicating direct binding .

  • Ca2+ binding: While less effective than Mg2+ at repressing transcription, Ca2+ also binds to the periplasmic domain . Interestingly, maximal repression of PhoP-activated genes is achieved when both Mg2+ and Ca2+ are present, suggesting a synergistic effect .

  • Binding site specificity: An avirulent mutant harboring a single amino acid substitution in the sensing domain of PhoQ exhibited lower affinity for Ca2+ but similar affinity for Mg2+, indicating that the binding sites for these cations are indeed distinct .

  • Cation competition with CAMPs: CAMPs directly compete with divalent cations for binding sites within the PhoQ PD acidic patch . This competition leads to activation of PhoQ by disrupting salt-bridges with the inner membrane .

The acidic patch of PhoQ contains negatively charged residues that form bridges with negatively charged membrane phospholipids in the presence of divalent cations, maintaining PhoQ in an inactive state .

How does the PhoQ W104C-A128C mutant differentiate between essential and non-essential sensing functions for virulence?

The PhoQ W104C-A128C mutant has been instrumental in differentiating between essential and non-essential sensing functions for virulence. This engineered variant contains a disulfide bond between W104C and A128C in the periplasmic domain that restrains conformational flexibility in α-helices 4 and 5 . The methodological approach to studying this mutant includes:

  • Engineering the disulfide bond using site-directed mutagenesis

  • Confirming disulfide bond formation in purified proteins and bacteria grown in culture

  • Assessing the mutant's response to different stimuli in vitro

  • Testing the mutant's virulence in animal infection models

The key findings from this approach revealed that:

  • PhoQ W104C-A128C is responsive to CAMPs but inhibited for activation by acidic pH and divalent cation limitation

  • Salmonella enterica Typhimurium expressing phoQ W104C-A128C is virulent in both susceptible BALB/c mice and relatively resistant A/J mice, similar to wild-type bacteria

  • The virulence of the mutant was significantly higher than that of a phoQ null (ΔphoQ) strain

These results indicate that acidic pH and divalent cation sensing by PhoQ are dispensable for virulence, while CAMP sensing appears to be sufficient for PhoQ-mediated virulence in the tested infection models .

What is the relative importance of different PhoQ-sensed signals during various stages of infection?

The relative importance of different PhoQ-sensed signals varies during different stages of infection. While the PhoQ W104C-A128C mutant studies indicate that acidic pH and divalent cation sensing are dispensable for systemic virulence, it remains possible that these sensing capabilities are important in other contexts .

Several hypotheses can be formulated based on the available evidence:

  • CAMP sensing may be the dominant PhoQ-stimulant during systemic infection

  • Sensing mechanisms may be redundant or host-compartment specific

  • Acidic pH and divalent cation sensing by PhoQ might be functions required for survival in ex vivo environments, beyond animal hosts

  • The contribution of acidic pH and divalent cation sensing to PhoQ-mediated bacterial survival may be more important during transition from the intestinal tract to systemic environments

How should researchers interpret conflicting data between in vitro and in vivo PhoQ activation studies?

When faced with conflicting data between in vitro and in vivo PhoQ activation studies, researchers should consider several methodological approaches:

  • Evaluate experimental conditions: In vitro conditions may not fully replicate the complex environment encountered by bacteria in vivo. Consider differences in pH, ion concentrations, presence of host factors, and redox conditions.

  • Assess protein modification status: Post-translational modifications or structural constraints may differ between in vitro and in vivo settings. For instance, disulfide bond formation efficiency could vary depending on the environment .

  • Consider redundant signaling pathways: Bacteria often have redundant signaling systems. What appears essential in vitro may be compensated for by other pathways in vivo.

  • Examine strain-specific differences: Different bacterial strains may show variations in PhoQ function or regulation.

  • Use genetic approaches to resolve discrepancies: Engineering specific mutations that separate different sensing capabilities (as with the W104C-A128C variant) can help determine which aspects of PhoQ function are critical in different contexts .

  • Employ diverse experimental readouts: Combine transcriptional reporter assays, biochemical measurements, structural studies, and virulence assays to build a more complete picture.

When specific conflicts arise, hypothesis-driven experimental design is critical to resolve discrepancies and advance understanding of PhoQ function.

What are the optimal experimental controls when studying PhoQ mutants in virulence models?

When studying PhoQ mutants in virulence models, optimal experimental controls should include:

  • Wild-type strain: Essential as the positive control to establish baseline virulence .

  • Complete deletion mutant (e.g., ΔphoQ): Critical negative control to demonstrate the complete loss of PhoQ function .

  • Complemented strain: A deletion mutant complemented with wild-type phoQ (either on a plasmid or chromosomally integrated) to confirm that phenotypes are specifically due to the absence of PhoQ.

  • Point mutant controls: Mutations that affect only one function of PhoQ while preserving others (like the W104C-A128C variant) help dissect specific contributions to virulence .

  • Multiple mouse strains: Testing in both susceptible (e.g., BALB/c) and resistant (e.g., A/J) mouse strains can reveal subtle virulence defects and confirm the robustness of findings .

  • Time course experiments: Assessing bacterial burden at multiple time points (e.g., 48- and 96-hours post-infection) provides insights into kinetics of infection .

  • Different infection routes: Depending on the research question, comparing intraperitoneal, oral, and other infection routes may be valuable.

  • In vitro functional validation: Confirming that mutants behave as expected in terms of response to relevant stimuli (pH, divalent cations, CAMPs) before in vivo testing .

  • Gene expression analysis: Measuring expression of PhoP-regulated genes in vitro and in vivo to confirm expected regulatory outcomes of mutations .

How can researchers effectively map the conformational changes in PhoQ using NMR spectroscopy?

NMR spectroscopy has proven to be a powerful tool for mapping conformational changes in the PhoQ periplasmic domain. An effective methodological approach includes:

  • Sample preparation: Express and purify isotopically labeled (15N, 13C) periplasmic domain of PhoQ for NMR analysis .

  • Resonance assignment: Assign the backbone and side-chain resonances of the PhoQ periplasmic domain using standard triple-resonance experiments.

  • pH titration experiments: Collect 1H-15N HSQC spectra at different pH values (e.g., pH 3.5 to pH 6.5) to identify pH-responsive regions .

  • Analysis of chemical shift perturbations (CSPs): Calculate and analyze CSPs to identify residues that experience significant pH-dependent changes (typically using a threshold of > 0.08 ppm) .

  • Analysis of resonance broadening: Identify resonances that broaden beyond detection as a function of pH, indicating intermediate-to-slow exchange and conformational dynamics .

  • Mapping affected residues: Map the affected residues onto the three-dimensional structure of PhoQ to identify structurally important regions .

Using this approach, researchers have identified that a majority of pH-sensitive residues in PhoQ localize to α1, α2, α4, and α5 and proximal regions, including β5, β6, and β7 . Many of these pH-sensitive residues form an interconnected network spanning α4 and α5 and the α/β-core .

What are the challenges in crystallizing full-length PhoQ and alternative approaches to structural determination?

Crystallizing full-length membrane proteins like PhoQ presents several challenges:

  • Membrane protein solubilization: Extraction from the membrane while maintaining native conformation is difficult.

  • Protein stability: Membrane proteins often have limited stability outside their native environment.

  • Conformational heterogeneity: Signal transduction proteins like PhoQ may exist in multiple conformational states.

  • Crystal contacts: The hydrophobic transmembrane regions limit potential crystal contacts.

Alternative approaches to structural determination include:

  • Domain-based approach: Determine structures of individual domains (periplasmic, transmembrane, cytoplasmic) separately, as demonstrated with the periplasmic domain .

  • Cryo-electron microscopy: Increasingly powerful for membrane protein structures without crystallization.

  • NMR spectroscopy: Particularly useful for studying dynamic regions and conformational changes in response to stimuli, as shown with pH titration of the periplasmic domain .

  • Computational modeling: Two-state computational models can predict conformational changes within the periplasmic dimerization interface and acidic patch .

  • Disulfide cross-linking: Strategic introduction of cysteine residues can trap specific conformational states, as demonstrated with the W104C-A128C variant .

  • Hydrogen-deuterium exchange mass spectrometry: Can provide information about solvent accessibility and conformational dynamics.

By combining these approaches, researchers can build comprehensive structural models of PhoQ signal transduction despite the challenges of full-length protein crystallization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.