The protein is expressed in E. coli with an N-terminal 6xHis tag for affinity purification. Critical production parameters include:
Chitin Binding: Recognizes and binds chitin via hevein domains, targeting GlcNAc trimers/tetramers .
Insecticidal Activity: Disrupts insect midgut epithelial cells by binding glycoproteins, potentially aiding pest control .
Low Toxicity: Unlike galactose-specific Viscum album agglutinin (VAA-I), this lectin exhibits minimal cytotoxicity in mammalian systems .
Agricultural Research: Explored as a biopesticide due to its chitin-binding properties and insecticidal effects .
Structural Studies: Serves as a model for understanding hevein domain interactions and lectin evolution .
Plant Defense Mechanisms: Linked to miRNA-regulated pathways in mistletoe, influencing lectin expression .
Structural Insights: The hevein domain’s β-sheet and α-helix folding stabilize chitin-binding activity, with residues Ser19, Trp21, and Trp23 critical for oligosaccharide recognition .
Expression Systems: Recombinant production in E. coli ensures high yield and scalability, though post-translational modifications may differ from native plant lectins .
Biological Relevance: Despite low toxicity, its insecticidal mechanism involves binding to peritrophic matrices and epithelial glycoconjugates, bypassing proteolytic degradation .
Viscum album Chitin-Binding Lectin (VisalbCBA) is a novel lectin isolated from European mistletoe (Viscum album) that differs completely from the classical galactose/N-acetylgalactosamine-binding mistletoe lectins MLI, MLII, and MLIII. While sharing the plant origin, VisalbCBA exhibits specificity towards oligomers of N-acetylglucosamine rather than galactose-based carbohydrates. Biochemically, it is a dimeric protein composed of two identical subunits of approximately 10 kDa, showing sequence homology to previously isolated chitin-binding plant proteins. Though it possesses cytotoxic properties, these are less pronounced than the classical mistletoe lectins that have been more extensively studied for their biological and therapeutic effects .
The recombinant form of Viscum album Chitin-Binding Lectin is typically produced in E. coli expression systems as a full-length protein with an N-terminal 6-His tag. Its molecular properties include:
| Property | Specification |
|---|---|
| UniProtKB ID | P81859 |
| Source Species | Viscum album (European mistletoe) |
| Expression System | E. coli |
| Tag | N-6His |
| Target Protein Sequence | IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL |
| Expression Range | 1-49aa |
| Protein Length | Full Length |
| Molecular Weight | 11.4 kDa |
| Purity | Greater than 85% (SDS-PAGE) |
The protein contains conserved cysteine residues that form disulfide bridges critical for maintaining its three-dimensional structure and functional properties .
The chitin-binding domain of VisalbCBA is homologous to hevein, a small basic glycine- and cysteine-rich polypeptide originally identified in the rubber tree (Hevea brasiliensis). These domains, also referred to as hevein domains, typically contain eight conserved cysteine residues (with some exceptions having six) that form disulfide bridges contributing to the protein's toxin-agglutinin fold. This structural motif is shared among various plant defense proteins, establishing a functional relationship between chitin-binding lectins and chitinases. Interestingly, some chitin-binding lectins possess chitinase activity, while certain chitinases are processed to become chitin-binding lectins, subsequently losing their chitinolytic activity .
The binding specificity of VisalbCBA towards N-acetylglucosamine oligomers is primarily attributed to its hevein-like domains. These domains possess a specific three-dimensional arrangement of amino acid residues that create a binding pocket complementary to the structure of N-acetylglucosamine. The conserved cysteine residues form disulfide bridges that maintain this binding pocket in the correct conformation. The protein undergoes sugar-protein interactions mediated by specific amino acid residues that recognize and form hydrogen bonds with the hydroxyl and acetamido groups of N-acetylglucosamine. Additionally, aromatic amino acids within the binding site often participate in CH-π interactions with the hydrophobic faces of the sugar rings, further stabilizing the carbohydrate-protein complex .
| Condition | Stability Properties |
|---|---|
| pH Range | Most stable in slightly basic conditions (pH 7.5-8.5) |
| Temperature | Maintains activity for extended periods at 4°C; stable during freeze-thaw when properly aliquoted |
| Storage Forms | Available as liquid in Tris/PBS-based buffer with 5-50% glycerol or as lyophilized powder with 6% Trehalose |
| Long-term Storage | Stable for up to 6 months at -20°C/-80°C in liquid form; longer in lyophilized form |
| Freeze-thaw Sensitivity | Repeated freeze-thaw cycles should be avoided; aliquoting recommended |
When reconstituting lyophilized protein, it's advisable to add 5-50% glycerol (final concentration) and create working aliquots to maintain stability and activity for extended periods .
The E. coli expression system has been successfully utilized for the production of functional recombinant VisalbCBA. When designing expression constructs, researchers should consider the following methodological approaches:
Vector Selection: Vectors containing T7 or similar strong promoters coupled with appropriate selection markers.
Strain Selection: BL21(DE3) or Rosetta strains often yield optimal expression for disulfide-containing proteins.
Expression Tags: N-terminal 6-His tags facilitate purification without significantly affecting protein function.
Induction Conditions: IPTG concentration (typically 0.1-1.0 mM), temperature (reduced to 16-25°C often improves folding), and duration (4-16 hours) should be optimized.
Disulfide Formation: Consider co-expression with disulfide isomerases or using strains engineered for disulfide bond formation.
The successful expression of functional VisalbCBA requires careful optimization of these parameters to ensure proper folding and formation of disulfide bridges crucial for the protein's activity .
A multi-step purification strategy typically yields recombinant VisalbCBA with purity greater than 85% while maintaining functional activity:
Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins effectively captures the His-tagged protein.
Intermediate Purification: Ion exchange chromatography, typically using cation exchange (given the protein's basic nature).
Polishing Step: Size exclusion chromatography separates dimeric active protein from aggregates and monomers.
Activity Retention: Including reducing agents (like DTT or β-mercaptoethanol) during lysis but removing them during later purification steps allows for proper disulfide formation.
Buffer Optimization: Final formulation in Tris/PBS-based buffer with glycerol stabilizes the protein.
Each purification step should be followed by activity assays to ensure that the functional integrity of the lectin is maintained throughout the process .
Several methodological approaches can be employed to assess the carbohydrate-binding activity of VisalbCBA:
Hemagglutination Assay: Measures the protein's ability to agglutinate erythrocytes, with inhibition studies using N-acetylglucosamine oligomers to confirm specificity.
Glycan Microarray Analysis: Provides a comprehensive profile of binding preferences across various oligosaccharides.
Isothermal Titration Calorimetry (ITC): Quantifies binding affinities and thermodynamic parameters of lectin-sugar interactions.
Surface Plasmon Resonance (SPR): Enables real-time analysis of binding kinetics.
Fluorescence Anisotropy: Using fluorescently-labeled oligosaccharides to measure binding interactions.
When conducting these assays, researchers should include appropriate controls such as heat-inactivated protein and competitive inhibition with specific oligosaccharides to validate binding specificity .
Although VisalbCBA is less toxic than other mistletoe lectins, it still exhibits cytotoxic properties that can be investigated using these approaches:
Cell Viability Assays: MTT, XTT, or WST-1 assays to determine dose-dependent cytotoxicity across various cell lines.
Apoptosis Detection: Flow cytometry with Annexin V/PI staining, TUNEL assays, or caspase activity measurements.
Cell Cycle Analysis: Flow cytometric analysis of propidium iodide-stained cells to determine cell cycle arrest patterns.
Protein Synthesis Inhibition Assays: Measuring incorporation of labeled amino acids to assess ribosome inactivation potential.
Competitive Inhibition Studies: Using N-acetylglucosamine oligomers to block cytotoxicity, confirming the role of carbohydrate binding in cell death.
These methodologies should be applied across multiple cell lines and time points to comprehensively characterize the cytotoxic profile of VisalbCBA .
VisalbCBA offers several valuable applications in cellular glycobiology research:
Glycoprotein Detection: As a probe for identifying and characterizing cellular glycoproteins containing N-acetylglucosamine residues.
Cell Surface Glycome Analysis: For mapping changes in cell surface glycosylation patterns during differentiation, malignant transformation, or in response to treatments.
Isolation of Glycoconjugates: As an affinity reagent for purifying glycoproteins containing N-acetylglucosamine moieties.
Intracellular Trafficking Studies: Fluorescently-labeled VisalbCBA can track the internalization and processing of glycoconjugates.
Glycosylation Inhibitor Validation: To assess the efficacy of drugs targeting glycosylation pathways.
When employing VisalbCBA for these applications, researchers should verify binding specificity using appropriate controls, including competitive inhibition with N-acetylglucosamine oligomers and comparison with other chitin-binding proteins .
While VAA-I (the classical mistletoe lectin) has been more extensively studied for immunomodulatory effects, VisalbCBA also demonstrates potential in this area:
Cytokine Production: VisalbCBA may stimulate the release of proinflammatory cytokines such as IL-1, IL-6, and TNF-α at non-toxic concentrations.
Immune Cell Activation: The protein could potentially influence various immune cell populations, with differential binding affinities to different cell types.
Dendritic Cell Maturation: May affect the maturation and antigen-presenting capacity of dendritic cells.
NK Cell Activity: Could influence natural killer cell function, potentially in synergy with cytokines like IL-2 and IL-12.
Gene Expression Profiling: RNA-seq or qPCR analysis after VisalbCBA treatment can reveal immunomodulatory gene expression patterns.
When investigating these effects, researchers should use dose-response studies and carefully distinguish between direct lectin effects and secondary responses to cytokine production .
The structure-function relationship between native and recombinant VisalbCBA presents an important research consideration due to potential differences in post-translational modifications:
Disulfide Bond Formation: The correct formation of disulfide bridges is critical for maintaining the hevein domain structure essential for carbohydrate binding. E. coli-expressed protein may require refolding or special expression conditions to ensure proper disulfide formation.
Glycosylation Patterns: Native VisalbCBA may contain glycosylation not present in E. coli-expressed protein, potentially affecting stability, half-life, and immunogenicity.
Proteolytic Processing: The native protein may undergo specific proteolytic processing events in the plant that are absent in recombinant systems.
Conformational Integrity: Spectroscopic techniques (circular dichroism, fluorescence spectroscopy) can assess whether recombinant protein maintains the same secondary and tertiary structures as the native form.
Functional Equivalence Testing: Comparative binding affinity measurements and biological activity assays between native and recombinant forms provide critical validation.
Researchers should characterize these differences systematically when interpreting experimental results or developing applications based on recombinant VisalbCBA .
The reduced toxicity of VisalbCBA compared to classical mistletoe lectins like MLI, MLII, and MLIII likely stems from several molecular mechanisms:
Ribosome Inactivation Potential: Unlike VAA-I, which has a potent ribosome-inactivating A-chain, VisalbCBA likely lacks this enzymatic activity or possesses it at reduced levels.
Cellular Internalization Efficiency: The binding specificity for N-acetylglucosamine rather than galactose may result in different patterns of cellular uptake and processing.
Apoptotic Pathway Activation: VisalbCBA may trigger different apoptotic signaling cascades or activate them with lower efficiency compared to other mistletoe lectins.
Domain Structure Differences: The absence of the characteristic A-B chain organization of ribosome-inactivating proteins (RIPs) in VisalbCBA contributes to its different toxic profile.
Binding Site Density Effect: The dimeric structure of VisalbCBA with two binding sites may create different clustering effects on cell membranes compared to the classical lectins.
Comparative studies examining protein synthesis inhibition, apoptosis induction mechanisms, and cellular binding patterns would help elucidate these differences in molecular detail .
Protein aggregation is a common challenge when working with recombinant lectins like VisalbCBA. Researchers can employ these methodological solutions:
Expression Optimization: Reduce induction temperature (16-20°C), decrease IPTG concentration, and extend expression time to promote proper folding.
Lysis Condition Refinement: Include mild detergents (0.1% Triton X-100), higher salt concentrations (300-500 mM NaCl), and optimize pH (typically 7.5-8.5) in lysis buffers.
Solubility Enhancers: Add glycerol (5-10%), arginine (50-100 mM), or low concentrations of urea (1-2 M) to buffers during purification.
Centrifugation Steps: Include high-speed centrifugation (100,000 × g) after lysis to remove microaggregates before chromatography.
Storage Formulation: Formulate final protein in buffers containing 5-50% glycerol or 6% trehalose at protein concentrations below 1 mg/mL to minimize aggregation during storage.
If aggregation persists, mild denaturation followed by controlled refolding in the presence of an appropriate redox system (oxidized/reduced glutathione) can help recover properly folded protein .
Loss of binding activity can significantly impact experimental outcomes. Consider these methodological approaches to troubleshoot and preserve activity:
Disulfide Bond Integrity: Avoid strong reducing agents during final purification steps and storage; use mild oxidizing conditions if reduction has occurred.
Metal Ion Contamination: Include EDTA (1-5 mM) in buffers to chelate metal ions that might interfere with protein structure.
Proteolytic Degradation: Add protease inhibitors during preparation and analyze protein integrity by SDS-PAGE before activity tests.
Activity Assay Validation: Include positive controls (commercial lectins with similar specificity) and systematically vary assay conditions (pH, temperature, buffer composition).
Sequential Aliquoting: Prepare small working aliquots to avoid repeated freeze-thaw cycles of the entire stock.
Researchers should also consider that apparent loss of activity may result from changes in the target carbohydrates rather than the lectin itself; control experiments with standard glycoconjugates can help distinguish these possibilities .
Functional comparison between VisalbCBA and other plant chitin-binding proteins reveals important distinctions relevant to research applications:
| Protein | Molecular Structure | Binding Specificity | Biological Activity | Research Applications |
|---|---|---|---|---|
| VisalbCBA | Dimeric, ~10 kDa subunits | Oligomers of N-acetylglucosamine | Moderate cytotoxicity, potential immunomodulation | Glycobiology, cell surface analysis, potential therapeutic research |
| Hevein | Monomeric, 4.7 kDa | Terminal N-acetylglucosamine | Antifungal activity, allergenicity | Antimicrobial studies, allergy research |
| Wheat Germ Agglutinin | Dimeric, 18 kDa | N-acetylglucosamine oligomers, sialic acid | Cell agglutination, enterocyte interaction | Cell labeling, intestinal biology |
| UDA (Urtica dioica Agglutinin) | Small lectin with hevein domains | Chitin derivatives | Antifungal, insecticidal | Plant defense studies, agricultural applications |
VisalbCBA's unique combination of moderate cytotoxicity with N-acetylglucosamine binding specificity positions it distinctively among plant chitin-binding proteins. While sharing the hevein domain structure with many of these proteins, its dimeric nature and specific biological activities make it particularly valuable for certain research applications, especially those exploring the intersection of glycobiology and cell death mechanisms .
Recombinant VisalbCBA and recombinant VAA (rVAA) differ substantially in several aspects:
Structural Organization:
rVAA: Heterodimeric protein with a cytotoxic A-chain (29 kDa) and a carbohydrate-binding B-chain (34 kDa)
VisalbCBA: Homodimeric protein composed of two identical ~10 kDa subunits
Carbohydrate Binding Specificity:
rVAA: Galactoside-specific, preferring certain galactose-containing conformations
VisalbCBA: Specifically binds to oligomers of N-acetylglucosamine
Mechanism of Cytotoxicity:
rVAA: Functions as a ribosome-inactivating protein (RIP), with the A-chain catalytically inhibiting protein synthesis in the 28S subunit of rRNA
VisalbCBA: Exhibits cytotoxicity through mechanisms that appear distinct from classical RIP activity
Immunomodulatory Effects:
rVAA: Well-documented effects including cytokine induction, NK cell activation, and apoptosis induction in various cell types
VisalbCBA: Less thoroughly characterized, but potentially activates different immunomodulatory pathways
Research Applications:
rVAA: Extensively used in cancer research, immunology, and as a component in mistletoe-based therapeutic approaches
VisalbCBA: More specialized applications in glycobiology research and as a tool for studying N-acetylglucosamine-containing structures
These differences highlight the complementary research value of these two mistletoe-derived lectins, with each providing distinct experimental capabilities .
Several emerging applications of VisalbCBA demonstrate significant potential in advancing glycobiology and cancer research:
Glycosylation-Based Cancer Biomarkers: VisalbCBA could serve as a probe for detecting altered N-acetylglucosamine patterns in tumor cells, potentially identifying novel biomarkers.
Targeted Drug Delivery Systems: Conjugating VisalbCBA with nanoparticles or liposomes may enable targeted delivery to cells expressing specific N-acetylglucosamine-containing glycans.
Chimeric Immunotoxins: Engineering fusion proteins combining VisalbCBA's binding domain with effector molecules could create novel targeted therapeutics.
Glycomics Platform Development: Incorporating VisalbCBA into high-throughput glycan analysis platforms to identify changes in N-acetylglucosamine presentation during cancer progression.
Combination Therapy Approaches: Investigating potential synergistic effects of VisalbCBA with conventional chemotherapeutics or immunotherapies in preclinical models.
These applications build upon our understanding of VisalbCBA's binding specificity and moderate cytotoxicity while leveraging advances in bioconjugation technology and glycobiology .
Genetic engineering offers several methodological approaches to enhance VisalbCBA's research utility:
Affinity Optimization: Site-directed mutagenesis of binding site residues could modify binding specificity or affinity for different N-acetylglucosamine-containing structures.
Domain Fusion Engineering: Creating chimeric proteins by fusing VisalbCBA with fluorescent proteins, enzymes, or cell-penetrating peptides to develop multifunctional research tools.
Stability Enhancement: Introducing additional disulfide bonds or using computational design to improve thermostability and resistance to degradation.
Expression Yield Improvement: Codon optimization and leader sequence modification for specific expression systems to increase production yields.
Multimerization Engineering: Designing constructs that promote controlled oligomerization to create multivalent binding proteins with enhanced avidity.
These engineering approaches could significantly expand the experimental applications of VisalbCBA while potentially addressing some of the current limitations in its production and use .