Recombinant Vitis vinifera Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Vitis vinifera (Grape)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQMKQV LANGKRGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPTKKNILVIGPVPG QKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITIADASDGRQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRIQGLLFFLSSVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: vvi:4025050

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Vitis vinifera Apocytochrome f and its biological significance?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Vitis vinifera (grape). This protein functions in the transfer of electrons from Photosystem II to Photosystem I. Specifically, it receives electrons from plastoquinol (PQH2) through the b6f complex and helps transfer them to plastocyanin (PC) . The "apo" prefix indicates the protein in its form before heme attachment, which is necessary for its proper function in electron transport. The cytochrome b6f complex plays a crucial role in converting light energy to chemical energy by contributing to the generation of a proton gradient across the thylakoid membrane that drives ATP synthesis .

How does Apocytochrome f integrate into the photosynthetic electron transport chain?

Apocytochrome f integrates into the cytochrome b6f complex, which serves as an intermediary complex between Photosystem II and Photosystem I in the Z-scheme of photosynthesis . The process follows this pathway:

  • Water is oxidized at Photosystem II, releasing electrons

  • These electrons are transferred to plastoquinone to form reduced plastoquinol (PQH2)

  • PQH2 transfers electrons to the b6f complex, where cytochrome f plays a crucial role

  • Cytochrome f then passes electrons to the soluble luminal protein plastocyanin (PC)

  • PC shuttles electrons to Photosystem I for the continuation of the electron transport chain

This electron transfer through cytochrome f contributes to building the proton gradient across the thylakoid membrane, which is essential for ATP synthesis.

What expression systems are available for recombinant Vitis vinifera Apocytochrome f production?

Multiple expression systems are available for the production of recombinant Vitis vinifera Apocytochrome f, each with specific advantages for different research applications:

Expression SystemProduct Code ExampleAdvantagesConsiderations
E. coliCSB-EP605908VFQ1High yield, cost-effective, rapid productionMay lack proper post-translational modifications
YeastCSB-YP605908VFQ1Better protein folding than E. coli, some post-translational modificationsModerate yield
BaculovirusCSB-BP605908VFQ1Good for complex proteins, eukaryotic post-translational modificationsMore time-consuming, higher cost
Mammalian cellsCSB-MP605908VFQ1Most authentic post-translational modificationsHighest cost, lowest yield, longest production time

Additionally, biotinylated versions (e.g., Avi-tag Biotinylated) are available for specialized applications requiring biotin-streptavidin interactions or immobilization .

What are the optimal storage and handling conditions for recombinant Apocytochrome f?

For optimal stability and activity of recombinant Vitis vinifera Apocytochrome f, researchers should follow these storage and handling guidelines:

  • Short-term storage: Store at 4°C for up to one week

  • Long-term storage: Store at -20°C or -80°C in aliquots to avoid repeated freeze-thaw cycles

  • Buffer composition: Use Tris-based buffer with 50% glycerol, optimized for protein stability

  • Reconstitution: Briefly centrifuge the vial before opening to bring contents to the bottom; reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage after reconstitution: Add glycerol to a final concentration of 5-50% (recommended 50%) and store in aliquots at -20°C/-80°C

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

How can researchers verify the quality and purity of recombinant Apocytochrome f?

To assess the quality and purity of recombinant Vitis vinifera Apocytochrome f, researchers should employ multiple analytical techniques:

  • SDS-PAGE: Evaluate protein purity, which should be >85% for research-grade preparations

  • Western blotting: Confirm protein identity using antibodies against cytochrome f or against the tag if present

  • Spectrophotometric analysis: Measure absorption spectra to confirm proper heme incorporation:

    • Reduced form: Strong absorption peaks at approximately 550 nm

    • Oxidized form: Characteristic absorption peaks at ~410 nm

  • Mass spectrometry: Verify protein mass and assess potential post-translational modifications

  • Functional assays: Test electron transfer capability using appropriate redox partners

How does heme attachment occur in cytochrome f and what factors are involved?

Heme attachment to cytochrome f requires a specialized process known as System II, which differs from the cytochrome c maturation systems in mitochondria. The process involves:

  • Key assembly factors: CCS1 and CcsA form a heme synthetase complex that catalyzes the covalent attachment of heme to cytochrome f

  • Heme binding motif: The CXXCH motif in cytochrome f serves as the attachment site for the heme group

  • Bacterial orthologs: ResB and ResC in B. subtilis and CcsBA in other bacteria serve similar functions to CCS1 and CcsA

The heme attachment process is critical for the function of cytochrome f in electron transport:

ComponentFunction in Heme Attachment
CCS1Part of the System II heme synthetase complex; essential for recognition and attachment of heme to cytochrome f
CcsAWorks with CCS1 to form the functional heme synthetase; may be involved in heme transport
CCS2A 170 kDa protein of the OPR family; required for cytochrome c assembly in Chlamydomonas reinhardtii
CCDAMay be involved in maintaining the reducing environment necessary for heme attachment

Disruption of these assembly factors results in the accumulation of apocytochrome f (without heme), which is non-functional in electron transport .

What are the challenges in expressing fully functional recombinant cytochrome f?

Expressing fully functional recombinant cytochrome f presents several challenges that researchers must address:

  • Heme incorporation: The expression system must support proper heme attachment to the CXXCH motif, which requires specific machinery not present in all host organisms

  • Membrane integration: As a transmembrane protein, cytochrome f requires proper insertion into membranes for function

  • Post-translational processing: In native systems, the petA gene product undergoes processing, including potential signal peptide cleavage

  • Protein folding: The complex structure requires correct folding to achieve functional conformation

  • Expression host selection: Different hosts (E. coli, yeast, baculovirus, mammalian cells) offer various trade-offs between yield and proper processing

Researchers can overcome these challenges by:

  • Using specialized E. coli strains engineered to express cytochrome c maturation genes

  • Co-expressing assembly factors like CCS1 and CcsA

  • Optimizing growth conditions to enhance heme availability

  • Employing eukaryotic expression systems for more complex post-translational processing

How can mutations in cytochrome f be analyzed to understand structure-function relationships?

To analyze structure-function relationships through mutations in cytochrome f, researchers can employ the following methodological approach:

  • Site-directed mutagenesis:

    • Target the CXXCH heme-binding motif to assess the importance of heme attachment

    • Mutate conserved residues potentially involved in interactions with plastocyanin

    • Alter potential membrane-spanning domains to assess membrane integration requirements

  • Expression and purification of mutants:

    • Express wild-type and mutant proteins in parallel under identical conditions

    • Purify using standardized protocols to enable direct comparisons

  • Functional analysis:

    • Spectroscopic measurements to assess heme incorporation

    • Electron transfer kinetics using artificial electron donors/acceptors

    • Reconstitution into liposomes to measure membrane potential generation

  • Structural analysis:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to evaluate conformational differences

    • Crystallography or cryo-EM for detailed structural insights (for major mutations)

  • Data interpretation:

    • Compare electron transfer rates between wild-type and mutant proteins

    • Correlate structural changes with functional impacts

    • Assess conservation of critical residues across species

How can researchers study cytochrome f in the context of the complete b6f complex?

To study cytochrome f within the complete b6f complex, researchers should employ a multi-faceted approach:

  • Isolation of intact b6f complex:

    • Solubilize thylakoid membranes using mild detergents (dodecyl maltoside or digitonin)

    • Perform multi-step purification using ion-exchange, hydroxyapatite, and size-exclusion chromatography

    • Verify complex integrity by SDS-PAGE, BN-PAGE, and immunoblotting

  • Functional reconstitution:

    • Incorporate purified b6f complex into liposomes

    • Measure electron transport from plastoquinol to plastocyanin

    • Assess proton translocation using pH-sensitive fluorescent dyes

  • Structural analysis:

    • Use cryo-electron microscopy for high-resolution structural determination

    • Perform cross-linking studies to map protein-protein interactions

    • Apply hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Genetic complementation studies:

    • Transform cytochrome f-deficient mutants with wild-type or modified petA genes

    • Assess restoration of photosynthetic electron transport

    • Measure growth rates and photosynthetic parameters

This comprehensive approach allows researchers to understand how cytochrome f functions within its native complex environment rather than as an isolated protein .

What biophysical techniques are most informative for studying cytochrome f electron transfer?

Several sophisticated biophysical techniques provide valuable insights into cytochrome f electron transfer mechanisms:

TechniqueInformation ObtainedMethodological Considerations
Transient absorption spectroscopyReal-time electron transfer kineticsRequires specialized laser equipment; can detect events in picosecond to millisecond range
Electron paramagnetic resonance (EPR)Electronic state of heme iron and surrounding environmentSample preparation critical; low temperature often required
Resonance Raman spectroscopyHeme environment and axial ligandsRequires proper laser excitation wavelengths matched to heme absorption
ElectrochemistryRedox potential determinationProtein immobilization on electrodes crucial for reproducible measurements
Potentiometric titrationsRedox potential in different environmentsRequires careful control of oxidizing/reducing agents and mediators

When applying these techniques, researchers should:

  • Compare results from multiple methods to build a comprehensive understanding

  • Include appropriate controls (denatured protein, heme-free variants)

  • Measure under physiologically relevant conditions (pH, ionic strength)

  • Consider the impact of detergents or lipid environment on electron transfer properties

How does cytochrome f from Vitis vinifera compare to homologs from other photosynthetic organisms?

Comparative analysis of cytochrome f across species reveals important evolutionary and functional insights:

These comparative analyses help researchers understand the core functional requirements for cytochrome f across diverse photosynthetic systems and identify potential targets for engineering enhanced photosynthetic efficiency .

How can researchers troubleshoot issues with recombinant cytochrome f activity?

When facing challenges with recombinant cytochrome f activity, researchers should systematically investigate these potential issues:

  • Heme incorporation problems:

    • Symptom: Protein lacks characteristic absorption peaks or has reduced electron transfer activity

    • Solution: Supplement growth media with δ-aminolevulinic acid to enhance heme biosynthesis; co-express heme attachment factors like CCS1 and CcsA

  • Protein misfolding:

    • Symptom: Low solubility, aggregation, or precipitation

    • Solution: Optimize expression temperature (lower to 16-20°C); use specialized E. coli strains; add folding enhancers like glycerol or arginine to buffers

  • Redox state issues:

    • Symptom: Inconsistent activity in electron transfer assays

    • Solution: Carefully control redox conditions; use fresh reducing agents; ensure anaerobic conditions when necessary

  • Degradation problems:

    • Symptom: Multiple bands on SDS-PAGE, decreasing activity over time

    • Solution: Add protease inhibitors during purification; optimize buffer conditions; store with glycerol at appropriate temperature

  • Improper membrane reconstitution:

    • Symptom: Low activity in liposome or membrane-based assays

    • Solution: Optimize lipid composition; ensure proper protein orientation; vary detergent removal methods

A systematic approach testing each variable individually while maintaining appropriate controls will help identify and resolve specific issues affecting protein activity.

What controls should be included in functional assays of cytochrome f?

Robust functional assays for cytochrome f require careful implementation of these critical controls:

  • Positive controls:

    • Native cytochrome f isolated from thylakoid membranes

    • Well-characterized recombinant cytochrome f preparation with known activity

    • Artificial electron donors/acceptors with defined kinetics

  • Negative controls:

    • Heat-denatured cytochrome f sample

    • Heme-free apocytochrome f (can be generated by expressing without heme supplementation)

    • Mutant with disrupted heme-binding site (CXXCH → AXXAH)

  • Specificity controls:

    • Reactions in the presence of specific inhibitors (e.g., DBMIB for Qo site inhibition)

    • Reactions with non-physiological electron donors/acceptors

    • Comparison with related but functionally distinct cytochromes

  • Technical controls:

    • Buffer-only reactions to establish baseline

    • Reactions at varied protein concentrations to ensure linearity

    • Time-course measurements to ensure steady-state conditions

  • Environmental controls:

    • pH series to determine optimal conditions and physiological relevance

    • Temperature variations to assess thermal stability

    • Ionic strength variations to evaluate electrostatic contributions to activity

Implementing these controls allows researchers to distinguish specific cytochrome f activity from artifacts and provides a framework for meaningful comparisons between experimental conditions.

What are the key considerations for designing experiments to study cytochrome f assembly in vivo?

When designing experiments to study cytochrome f assembly in vivo, researchers should address these critical considerations:

  • Genetic approach selection:

    • CRISPR/Cas9 genome editing for precise modifications of petA or assembly factors

    • RNA interference or antisense approaches for transient knockdown studies

    • Complementation of knockout lines with modified variants

  • Reporter system design:

    • Fluorescent protein fusions must preserve protein function

    • Split-GFP or FRET systems can detect protein-protein interactions

    • Epitope tags should be positioned to avoid interference with assembly

  • Assembly factor analysis:

    • Co-immunoprecipitation to identify interacting partners

    • Proximity labeling (BioID or APEX) to map the assembly interactome

    • Pulse-chase experiments to track assembly kinetics

  • Phenotypic assessments:

    • Chlorophyll fluorescence to measure photosynthetic electron transport

    • Growth analysis under varying light conditions

    • Oxygen evolution measurements to assess PSII-to-PSI electron flow

  • Subcellular localization:

    • Immunogold electron microscopy for precise localization

    • Super-resolution microscopy to track assembly intermediates

    • Membrane fractionation to isolate assembly intermediates

The assembly of functional cytochrome f involves multiple factors including CCS1, CcsA, and potentially CCS2, which coordinate heme attachment and proper integration into the b6f complex . Experiments should be designed to capture the dynamic nature of this process and the interactions between assembly factors and their substrate proteins.

How might synthetic biology approaches enhance our understanding of cytochrome f?

Synthetic biology offers innovative approaches to advance cytochrome f research:

  • Designer cytochrome f variants:

    • Create minimal functional units to determine essential structural elements

    • Engineer variants with altered redox potentials through heme environment modifications

    • Develop chimeric proteins combining domains from different species to understand evolutionary adaptations

  • Orthogonal expression systems:

    • Establish bacterial systems expressing complete cytochrome f assembly machinery

    • Develop cell-free expression systems for rapid prototyping

    • Create synthetic organelles with controlled composition for assembly studies

  • Novel biophysical probes:

    • Incorporate unnatural amino acids for site-specific attachment of spectroscopic probes

    • Design split-reporter systems to monitor assembly in real-time

    • Develop sensors that respond to electron transfer events

  • Directed evolution:

    • Apply selection pressure to identify variants with enhanced stability or activity

    • Screen for cytochrome f variants that function with alternative electron donors/acceptors

    • Evolve assembly factors with improved efficiency

  • Model system development:

    • Create simplified synthetic membranes with defined composition

    • Develop minimal photosynthetic circuits for testing electron transfer components

    • Engineer test beds for evaluating b6f assembly in heterologous systems

These synthetic biology approaches could overcome limitations of traditional biochemical and genetic methods, potentially revealing new insights into the fundamental mechanisms of cytochrome f function and assembly.

What are the implications of cytochrome f research for enhancing photosynthetic efficiency?

Understanding cytochrome f structure and function has significant implications for enhancing photosynthetic efficiency:

  • Bottleneck identification:

    • The cytochrome b6f complex often represents a rate-limiting step in photosynthetic electron transport

    • Detailed understanding of cytochrome f could reveal engineering targets to alleviate this bottleneck

  • Stress tolerance engineering:

    • Knowledge of how cytochrome f stability impacts photosynthesis under stress conditions

    • Potential to engineer variants with enhanced stability under high light, temperature, or drought

  • Pathway optimization:

    • Understanding rate-limiting steps in electron transfer

    • Potential to optimize cytochrome f-plastocyanin interactions for more efficient electron transfer

  • Synthetic pathway development:

    • Creating novel electron transport chains incorporating engineered cytochrome f variants

    • Designing artificial photosynthetic systems for biotechnology applications

  • Crop improvement applications:

    • Transferring beneficial cytochrome f variants to crop plants

    • Engineering more efficient electron transport to increase carbon fixation rates

The research on apocytochrome f and its assembly into functional cytochrome f directly contributes to our fundamental understanding of photosynthesis, with potential applications for addressing global challenges in food security and renewable energy production .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.