Recombinant Vitis vinifera ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role of Recombinant Vitis vinifera ATP Synthase Subunit a, Chloroplastic (AtpI)

Recombinant Vitis vinifera ATP synthase subunit a, chloroplastic (AtpI), is a genetically engineered protein derived from the chloroplast-localized atpI gene of grapevine (Vitis vinifera). This subunit is a critical component of the ATP synthase complex (CF₀-CF₁), which catalyzes ATP production in chloroplasts during photosynthesis . The recombinant form is synthesized in heterologous expression systems (e.g., E. coli or yeast) for biochemical and functional studies, enabling precise analysis of its role in energy transduction and chloroplast metabolism .

Functional Domains

  • Transmembrane Helices: AtpI contains 4–6 membrane-spanning regions critical for proton translocation across the thylakoid membrane .

  • Conserved Motifs: Includes residues essential for binding the F₀ rotor (subunit c-ring) and stabilizing ATP synthase assembly .

Cloning and Expression

  • The atpI gene is cloned into expression vectors under strong promoters (e.g., T7 or GAL1) and transformed into microbial hosts .

  • Purification: Affinity chromatography (e.g., His-tag) followed by gel filtration for homogeneity .

Experimental Use Cases

StudyApplicationKey Insight
Vacuole Isolation (Kuang et al., 2019)Western blot analysisAtpI localizes to chloroplast membranes, confirming its role in ATP synthase assembly .
Chloroplast Genome Analysis (Meskhuri et al., 2018)SSR marker developmentatpI exhibits conserved A/T-rich repeats, aiding phylogenetic studies .
Metabolic Modeling (iMS7199, 2024)Systems biology integrationAtpI is integrated into V. vinifera metabolic networks to simulate ATP flux .

Functional Insights

  • Energy Coupling: AtpI facilitates proton gradient-driven ATP synthesis in chloroplasts, with mutations reducing F₀ stability and ATPase activity .

  • Stress Response: Upregulated under light stress, correlating with enhanced photosynthetic efficiency .

Gene Conversion Events

  • Interorganellar Transfer: Chloroplast atpA (homolog of mitochondrial atp1) shows evidence of gene conversion in angiosperms, highlighting evolutionary conservation .

  • Conservation: 56.2% amino acid identity between V. vinifera AtpI and mitochondrial ATP synthase subunits .

Challenges and Future Directions

  • Structural Resolution: Cryo-EM studies are needed to resolve AtpI’s role in rotor-stator interactions.

  • Stress Adaptation: Link AtpI expression to abiotic stress tolerance in grapevines using CRISPR/Cas9 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; GSVIVT00013243001; LOC100246719; VIVICP009; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSATLAVRN PQTIPTDGQNFFEYVLEFIRDVSKTQIGEEYGSWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSIVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: vvi:4025095

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for producing recombinant Vitis vinifera ATP synthase subunit a?

E. coli BL21(DE3) cells are the preferred expression system for recombinant chloroplastic ATP synthase subunits, including atpI from Vitis vinifera. This bacterial strain is engineered to maximize protein production through the T7 RNA polymerase expression system . For optimal expression:

  • Maintain growth temperature at 30°C rather than 37°C to minimize inclusion body formation

  • Induce expression at OD600 of 0.6-0.8 with 0.5 mM IPTG

  • Conduct expression for 4-6 hours post-induction for membrane proteins like atpI

  • Include 1% glucose in the pre-induction medium to prevent leaky expression

Protein yields typically range from 2-5 mg/L of culture for membrane proteins like ATP synthase subunit a, which is lower than soluble proteins due to their hydrophobic nature.

What purification strategy yields the highest purity for recombinant atpI protein?

Immobilized metal affinity chromatography (IMAC) using Ni-nitrilotriacetic acid (Ni-NTA) columns is the recommended first purification step for 6×His-tagged recombinant atpI protein . To achieve >95% purity:

  • Solubilize membrane fractions using 1-2% mild detergent (n-dodecyl β-D-maltoside preferred)

  • Load solubilized protein onto a Ni-NTA column pre-equilibrated with buffer containing 0.05% detergent

  • Wash with increasing imidazole concentrations (10-40 mM) to remove non-specific binding

  • Elute purified protein with 250-300 mM imidazole

  • Follow with size exclusion chromatography for highest purity

This approach typically yields 1-2 mg of purified protein per liter of bacterial culture with >95% purity as confirmed by SDS-PAGE analysis.

How should researchers handle and store recombinant Vitis vinifera atpI protein to maintain activity?

The chloroplastic ATP synthase subunit a from Vitis vinifera requires special handling to maintain structural integrity and function:

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Working aliquots can be maintained at 4°C for up to one week

  • Include 0.02-0.05% detergent in storage buffer to prevent aggregation of this membrane protein

  • Add 1 mM DTT to prevent oxidation of cysteine residues

Activity typically decreases by approximately 10-15% per month even under optimal storage conditions, so fresh preparations are recommended for critical experiments.

What techniques are most effective for studying protein-protein interactions between atpI and other ATP synthase subunits?

Several complementary approaches provide insights into atpI interactions within the ATP synthase complex:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpI or other subunits to pull down interaction partners

  • Yeast two-hybrid (Y2H) assays: Particularly useful for mapping specific interaction domains

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in live cells

  • Cross-linking coupled with mass spectrometry: To identify direct contacts between subunits

Research has shown that chloroplast ATP synthase subunit a interacts primarily with subunits b and c within the membrane-embedded Fo portion, forming the proton channel essential for ATP synthesis . These interactions are highly conserved across plant species, with approximately 85% sequence identity in the interaction domains between Vitis vinifera and other plants.

How does the structure of Vitis vinifera atpI compare to homologous proteins from other plant species?

Vitis vinifera ATP synthase subunit a shares significant structural conservation with homologs from other plants:

SpeciesSequence Identity (%)Length (amino acids)Key Structural Differences
Vitis vinifera100247Reference sequence
Arabidopsis thaliana89249Additional 2 amino acids in N-terminus
Spinacia oleracea87247Conservative substitutions in transmembrane regions
Oryza sativa82247Variable residues in stromal-facing loops
Chlamydomonas reinhardtii76246One amino acid deletion in C-terminus

The protein contains multiple transmembrane helices that form part of the proton channel. Critical functional residues, including those involved in proton translocation, are nearly 100% conserved across all plant species, indicating their essential role in ATP synthesis .

What is the role of atpI in the assembly and function of chloroplast ATP synthase?

The atpI-encoded subunit a plays several critical roles in ATP synthase:

  • Forms the stationary portion of the proton channel alongside subunit c-ring

  • Contains essential residues for proton translocation, including conserved arginine residues

  • Mediates coupling between proton movement and rotary catalysis

  • Contributes to the stability of the entire Fo sector

Studies have demonstrated that mutations in subunit a can block ATP synthesis without affecting ATPase activity, indicating its crucial role in coupling proton movement to the conformational changes required for ATP synthesis . The subunit a of chloroplast ATP synthase is encoded by the plastid gene atpI in Vitis vinifera, underscoring the coordinated expression between nuclear and plastid genomes required for ATP synthase biogenesis .

What strategies can overcome the challenges of expressing recombinant membrane proteins like atpI?

Expression of integral membrane proteins like atpI presents unique challenges that can be addressed through several approaches:

  • Fusion protein strategy: Fusion with soluble partners such as SUMO, thioredoxin, or MBP can increase solubility

  • Codon optimization: Adjusting codon usage to match the expression host can increase yields by 2-3 fold

  • Specialized expression strains: E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • Cell-free expression systems: For difficult-to-express proteins, using wheat germ extract supplemented with lipids

Researchers have reported that inclusion of specific chaperones (GroEL/GroES) can increase functional yields of chloroplast ATP synthase subunits by up to 40% by preventing misfolding and aggregation . Additionally, lowering expression temperature to 18-20°C and extending expression time to 16-24 hours can significantly improve the yield of correctly folded membrane proteins.

How can researchers effectively study the proton translocation function of recombinant atpI?

Studying proton translocation through ATP synthase subunit a requires reconstitution into a membrane environment:

  • Liposome reconstitution: Purified recombinant atpI can be incorporated into liposomes alongside other Fo subunits

  • pH-sensitive fluorescent probes: Probes like ACMA or pyranine can monitor proton movement across membranes

  • Patch-clamp electrophysiology: For direct measurement of proton currents

  • Site-directed mutagenesis: To identify essential residues involved in proton translocation

Experiments should establish a proton gradient using either acid-base transitions or light-driven proton pumps when working with reconstituted systems. The efficiency of proton translocation can be assessed by measuring the decay of the established gradient over time. Studies have shown that conserved arginine residues in transmembrane helix 4 of subunit a are essential for proton translocation, with mutations resulting in >95% reduction in activity .

What approaches can elucidate the stoichiometry and assembly pathway of ATP synthase incorporating recombinant atpI?

Understanding the incorporation of recombinant atpI into the complete ATP synthase complex requires several complementary approaches:

  • Blue native PAGE: For analyzing intact complexes and sub-complexes

  • Pulse-chase experiments: To track the assembly process temporally

  • Cryo-electron microscopy: For structural determination of the assembled complex

  • Cross-linking coupled with mass spectrometry: To identify interaction partners during assembly

Research has established that chloroplast ATP synthase assembly follows a defined pathway where the membrane-embedded Fo sector (including atpI) assembles separately from the F1 sector before joining to form the complete complex . The biogenesis involves specific assembly factors, including PROTEIN IN CHLOROPLAST ATPASE BIOGENESIS (PAB) and BIOGENESIS FACTOR REQUIRED FOR ATP SYNTHASE 1 (BFA1) .

What approaches are most effective for studying the evolution of atpI across plant species?

Evolutionary analysis of atpI requires multiple computational and experimental approaches:

  • Phylogenetic analysis: Using maximum likelihood or Bayesian methods to construct evolutionary trees

  • Selection pressure analysis: Calculating dN/dS ratios to identify sites under purifying or positive selection

  • Ancestral sequence reconstruction: To infer the sequence of atpI in common ancestors

  • Structural homology modeling: To map evolutionary changes onto protein structure

Studies have shown that chloroplast ATP synthase subunits, including atpI, are under strong purifying selection across the plant kingdom, indicating functional constraints. The atpI gene has remained in the plastid genome throughout plant evolution, unlike some other ATP synthase subunits that have been transferred to the nuclear genome . Sequence identity of atpI across land plants typically ranges from 75-90%, with most variation occurring in loop regions rather than transmembrane domains.

How can CRISPR-Cas9 be utilized to study atpI function in vivo?

CRISPR-Cas9 technology offers powerful approaches for studying chloroplast genes like atpI:

  • Plastid transformation: Using biolistic delivery of CRISPR components targeted to the chloroplast genome

  • Inducible systems: Employing inducible promoters to control the timing of gene editing

  • Base editing: For introducing specific point mutations without double-strand breaks

  • Knock-in strategies: For adding reporter tags to monitor protein localization and dynamics

When designing guide RNAs for chloroplast genes, researchers should target unique sequences that don't have homology elsewhere in the chloroplast genome to avoid off-target effects. For atpI, the survival of plants with edited versions depends on the nature of the modification—complete knockout is typically lethal, while point mutations affecting specific functions may generate viable plants with interesting phenotypes related to photosynthetic efficiency.

What bioinformatic approaches can predict the impact of mutations in Vitis vinifera atpI on ATP synthase function?

Several computational approaches can predict the functional consequences of atpI mutations:

  • Homology modeling: Creating structural models based on related proteins with known structures

  • Molecular dynamics simulations: Simulating the behavior of wild-type and mutant proteins

  • Conservation analysis: Identifying highly conserved residues likely to be functionally important

  • Protein-protein interaction prediction: Assessing how mutations might affect subunit interactions

These approaches have revealed that mutations in the transmembrane helices of atpI, particularly those facing the c-ring rotation path, have the most severe impacts on function. For example, mutations of conserved arginine residues in the fourth transmembrane helix completely abolish the coupling between proton translocation and ATP synthesis without affecting complex assembly .

How can recombinant atpI be used to study plant responses to environmental stresses?

Recombinant Vitis vinifera atpI can be a valuable tool for investigating plant stress responses:

  • In vitro activity assays: Measuring ATP synthase activity under different pH, temperature, or ionic conditions

  • Anti-atpI antibodies: Using recombinant protein to generate specific antibodies for monitoring endogenous protein levels

  • Protein-protein interaction studies: Identifying stress-responsive proteins that interact with atpI

  • Structural studies: Examining conformational changes under stress conditions

Research has shown that under abiotic stresses such as cold, drought, or high light, the association between ATP synthase subunits can be altered. The cF1 can partially dissociate from cFo (30% present in stroma vs. 70% bound to thylakoids under normal conditions), with this ratio changing depending on external conditions . This dynamic regulation appears to be involved in plant acclimation to environmental conditions.

What methods can assess the impact of post-translational modifications on recombinant atpI function?

Several approaches can identify and characterize post-translational modifications (PTMs) of atpI:

  • Mass spectrometry: For identifying specific PTMs and their locations

  • Site-directed mutagenesis: Converting modified residues to non-modifiable amino acids

  • In vitro modification systems: Using purified enzymes to introduce specific PTMs

  • Activity assays: Comparing the function of modified versus unmodified protein

Studies of chloroplast ATP synthase have identified several PTMs including phosphorylation, acetylation, and redox modifications that can affect enzyme activity. These modifications appear to play roles in regulating ATP synthase activity in response to changing light conditions and metabolic demands . Researchers can generate recombinant atpI with site-specific mutations at PTM sites to create constitutively active or inactive forms for functional studies.

How can researchers engineer recombinant atpI to improve photosynthetic efficiency?

Engineering ATP synthase subunit a offers potential approaches to enhance photosynthetic efficiency:

  • Altering proton-to-ATP ratio: Modifications to change the stoichiometry of protons required per ATP

  • Reducing photoinhibition: Engineering variants less susceptible to damage under high light

  • Improving activation/deactivation kinetics: Modifications to responsiveness to light transitions

  • Cross-species chimeric proteins: Incorporating beneficial features from different plant species

What strategies can overcome protein aggregation during recombinant atpI purification?

Membrane proteins like atpI are prone to aggregation, which can be addressed through:

  • Detergent screening: Testing multiple detergents (DDM, LMNG, digitonin) at various concentrations

  • Addition of stabilizing agents: Including glycerol (10-20%) or specific lipids

  • Purification temperature adjustment: Conducting all steps at 4°C

  • Buffer optimization: Testing different pH values and ionic strengths

For Vitis vinifera atpI, researchers have found that a combination of 0.03% DDM with 0.003% CHS (cholesteryl hemisuccinate) provides optimal stability. Additionally, including 10 mM ATP in purification buffers can help stabilize the protein by mimicking its natural ligand environment. Dynamic light scattering can be used to monitor aggregation state during purification optimization.

How can researchers validate the functional integrity of purified recombinant atpI?

Confirming that purified recombinant atpI retains its native structure and function requires several approaches:

  • Circular dichroism spectroscopy: To verify secondary structure content

  • Limited proteolysis: Comparing digestion patterns of recombinant and native proteins

  • Binding assays: Testing interaction with known partner subunits

  • Reconstitution studies: Incorporating purified protein into liposomes or nanodiscs

For ATP synthase subunit a, functional validation should include reconstitution with other Fo subunits to form a proton-conducting complex. The reconstituted complex should demonstrate proton translocation activity when a pH gradient is established. This activity is typically measured using pH-sensitive fluorescent dyes, with functional protein showing approximately 60-70% of the activity observed in native thylakoid membranes.

What are the most common pitfalls in functional studies of recombinant atpI and how can they be addressed?

Researchers should be aware of several common challenges when working with recombinant atpI:

  • Incomplete denaturation on SDS-PAGE: Use 8M urea in addition to SDS for complete denaturation

  • False positives in interaction studies: Include appropriate controls for non-specific binding

  • Loss of activity during reconstitution: Optimize lipid composition to match native environment

  • Misfolding during expression: Consider fusion partners or chaperone co-expression

One particular challenge is distinguishing between direct effects on ATP synthase activity versus indirect effects on complex assembly. To address this, researchers should perform both activity measurements and assembly analysis (via native PAGE) in parallel. Additionally, when conducting mutagenesis studies, conservative substitutions should be used initially to minimize structural disruption while probing specific functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.