Recombinant Vitis vinifera ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vitis vinifera ATP Synthase Subunit b (atpF)

The recombinant Vitis vinifera ATP synthase subunit b (atpF) is a chloroplast-localized protein critical for ATP synthesis in plants. It belongs to the F₀ sector of the chloroplast ATP synthase (CF₀CF₁ complex), which couples proton translocation across thylakoid membranes to ATP production. This recombinant form is engineered for research, typically expressed in E. coli with an N-terminal His tag to facilitate purification .

Challenges:

  • Membrane Protein Solubility: Subunit b’s hydrophobic regions require detergents (e.g., DDM) for solubilization .

  • Post-Translational Modifications: Phosphorylation or glycosylation may influence activity in chloroplasts .

Functional Assays

  • ATP Synthesis Activity: Recombinant atpF reconstituted with other subunits (e.g., d, F₆) restores proton-driven ATP synthesis in vitro .

  • Mutation Analysis: Site-directed mutagenesis of conserved residues (e.g., Lys55, Glu149 in analogous proteins) ablates nuclease activity, highlighting critical residues for function .

Interaction Studies

  • Subunit Interactions: Co-expression of atpF with subunits d and F₆ in E. coli enables isolation of the peripheral stalk complex for biochemical studies .

  • Regulatory Interactions: 14-3-3 proteins (e.g., VV1_CS, VV2_CS) bind phosphorylated targets in flavonoid biosynthesis, suggesting potential regulatory roles in chloroplast ATP synthase .

Comparative Analysis of Recombinant atpF Preparations

SupplierSpeciesTagExpression HostApplication
Creative BioMart Vitis viniferaHisE. coliStructural/functional studies
CD BioSciences Oryza nivaraHisE. coliATP synthase reconstitution
Agrisera ArabidopsisNativeE. coliAntibody validation (subunits α/γ)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
atpF
Target Protein Sequence
MKNVTDSFVSLGHWPSAGGFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLRKVEMEADQYRVNGYSEIEREKLNLINSTYNTLEQ LENYKNETIHFEQQRAINQVRQRVLQQALQGALGTINSCLNKELHLRTISANIGMFGSMK EIRNN
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).

Database Links

KEGG: vvi:4025115

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b in chloroplasts?

ATP synthase subunit b (atpF) is a critical component of the peripheral stalk of chloroplast ATP synthase, connecting the membrane-embedded F0 domain with the catalytic F1 domain. This peripheral stalk functions as a stator that prevents the F1 domain from rotating with the central stalk during ATP synthesis. In chloroplasts, ATP synthase harnesses the proton gradient established during photosynthesis to generate ATP, which powers various cellular processes in the plant.

Studies with photosynthetic organisms have demonstrated that peripheral stalk subunits are essential for ATP synthase function. For example, in Chlamydomonas reinhardtii, frame-shift mutations in atpF completely prevent ATP synthase function and accumulation . This highlights the critical role of subunit b in maintaining not only the functionality but also the structural stability of the entire ATP synthase complex. Without properly assembled peripheral stalks, the enzyme cannot effectively couple proton movement through the F0 domain to ATP synthesis in the F1 domain.

How can researchers express and purify recombinant Vitis vinifera atpF protein?

Expression and purification of recombinant Vitis vinifera atpF protein presents several challenges due to its membrane-associated nature. Researchers typically employ the following methodological approaches:

For bacterial expression, E. coli systems using vectors such as pET series with T7 promoters provide a starting point. When designing expression constructs, researchers should consider removing the transit peptide sequence that targets the protein to chloroplasts, as this can interfere with proper folding in bacterial systems. Expression conditions often require optimization, with lower temperatures (16-20°C) and reduced inducer concentrations helping to improve soluble protein yields.

For purification, a multi-step approach is most effective. Initial affinity chromatography using tags such as His6 or GST allows for capture of the target protein. The presence of mild detergents (0.1-1% DDM, Triton X-100, or CHAPS) in all buffers is crucial to maintain solubility of the hydrophobic transmembrane domains. Following affinity purification, size exclusion chromatography helps remove aggregates and improve purity.

Protein quality should be assessed using SDS-PAGE, Western blotting, and mass spectrometry. Functional validation through ATP synthase activity assays or complementation studies in model organisms provides crucial evidence of proper folding and functionality. Similar approaches have been successfully used for expressing and studying ATP synthase subunits from other organisms .

What techniques are most effective for studying atpF-protein interactions?

Understanding protein-protein interactions involving atpF is essential for elucidating its function in the ATP synthase complex. The following methodological approaches are most effective:

Co-immunoprecipitation (Co-IP) using antibodies against atpF or its interacting partners can reveal native interactions in plant extracts. This approach requires careful optimization of extraction conditions to maintain membrane protein complexes. Controls should include immunoprecipitation with non-specific antibodies and RNase treatment to determine if interactions are RNA-dependent, similar to protocols used in studies of other ATP synthase interactions .

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) followed by second-dimension SDS-PAGE or mass spectrometry allows visualization of intact ATP synthase complexes and subcomplexes. This technique has been successfully employed to study ATP synthase assembly in Chlamydomonas reinhardtii and can reveal how atpF contributes to complex stability and formation.

For direct physical interactions, in vitro binding assays using purified proteins provide compelling evidence. GST pull-down assays with GST-tagged atpF and potential interacting partners can demonstrate direct binding, similar to approaches used in studying ATP synthase subunit interactions . Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can further quantify binding affinities and kinetics.

Crosslinking approaches coupled with mass spectrometry provide spatial information about protein interactions, identifying specific residues at interaction interfaces. This is particularly valuable for understanding how atpF interacts with other subunits in the assembled complex.

What are the common challenges in analyzing atpF gene expression?

Analysis of atpF gene expression presents several methodological challenges that researchers must address:

Chloroplast gene extraction requires specialized protocols due to the abundance of photosynthetic proteins and secondary metabolites in leaf tissues that can interfere with nucleic acid purification. Modifications to standard extraction protocols, including additional purification steps and the use of specific buffers, are often necessary to obtain high-quality RNA from chloroplasts.

Quantitative RT-PCR for chloroplast genes requires careful selection of reference genes. Unlike nuclear genes, chloroplast genes may be present in multiple copies per cell, and their expression can vary significantly under different environmental conditions. Validation of multiple reference genes is essential for accurate normalization.

Post-transcriptional processing of atpF transcripts presents another challenge. The atpF gene typically contains an intron, requiring analysis of both spliced and unspliced forms to fully understand expression regulation. Northern blotting or specialized RT-PCR approaches can distinguish between these forms and provide insights into processing efficiency.

Coordinated regulation with nuclear-encoded ATP synthase subunits requires simultaneous analysis of both chloroplast and nuclear gene expression. This necessitates protocols that can effectively extract and analyze both RNA populations, adding complexity to experimental design and data interpretation. Studies in Chlamydomonas reinhardtii have demonstrated that nuclear factors can significantly affect the stability and processing of chloroplast-encoded ATP synthase transcripts .

How does the topology of atpF within the thylakoid membrane affect ATP synthase assembly?

The topology of atpF within the thylakoid membrane is a critical determinant of ATP synthase assembly and function. Research approaches to address this question include:

Cysteine scanning mutagenesis can systematically map the transmembrane topology by introducing cysteine residues at different positions and using membrane-impermeable sulfhydryl reagents to determine accessibility. This approach has been successfully employed in studying membrane protein topology and can reveal how atpF traverses the thylakoid membrane.

When expressed in heterologous systems, topology can be investigated using protease protection assays, where samples are treated with proteases in the presence or absence of membrane permeabilization. This reveals which domains are protected by the membrane versus those exposed to the external environment.

Cryo-electron microscopy studies of purified ATP synthase complexes can resolve the structural arrangement of atpF within the membrane. By determining how the transmembrane domain is positioned relative to other F0 components, researchers can understand how atpF contributes to proton translocation and complex stability.

Studies in Chlamydomonas reinhardtii have shown that mutations affecting the peripheral stalk subunits (b and b') prevent ATP synthase function and accumulation . This suggests that proper positioning of these subunits within the membrane is essential for complex assembly. Researchers studying Vitis vinifera atpF can draw parallels from these findings while investigating the specific topology of grapevine atpF.

What role does atpF play in coordinating nuclear and chloroplast gene expression during ATP synthase biogenesis?

ATP synthase biogenesis represents a fascinating example of coordinated expression between nuclear and chloroplast genomes, with atpF playing a central role in this process:

Pulse-chase experiments using metabolic labeling can track the assembly kinetics of ATP synthase, revealing the temporal order in which subunits associate during complex formation. This approach can determine whether atpF incorporation is an early or late step in the assembly process, providing insights into its role in coordinating complex biogenesis.

The analysis of ATP synthase assembly in nuclear mutants affecting chloroplast gene expression can reveal regulatory pathways. For example, studies in Chlamydomonas reinhardtii identified MDE1, a nuclear-encoded octotricopeptide repeat protein required for stabilizing the chloroplast-encoded atpE mRNA . Similar nuclear factors likely regulate atpF expression, and their identification provides insights into nucleus-chloroplast coordination.

Comparative genomics approaches analyzing the co-evolution of nuclear and chloroplast-encoded ATP synthase subunits can reveal evolutionary patterns in this coordination. As demonstrated in C. reinhardtii, the recruitment of nuclear factors to regulate chloroplast gene expression can be a relatively recent evolutionary event , potentially differing between plant species.

RNA-binding protein identification using RNA immunoprecipitation followed by sequencing (RIP-seq) can identify nuclear-encoded proteins that bind to atpF transcripts and regulate their processing, stability, or translation. This approach has revealed numerous nuclear factors that regulate chloroplast gene expression in various plant species.

How do mutations in atpF affect ATP synthase assembly and photosynthetic efficiency?

Investigating the effects of atpF mutations on ATP synthase assembly and photosynthetic efficiency requires a multi-faceted approach:

Site-directed mutagenesis targeting key residues in different atpF domains can create a library of variants for functional analysis. Residues involved in protein-protein interactions, membrane integration, or structural stability would be primary targets. These mutants can be expressed in heterologous systems or introduced into chloroplast genomes through transformation.

Chloroplast transformation techniques, although technically challenging, allow replacement of the native atpF gene with mutated versions. This approach has been successfully applied in model organisms like Chlamydomonas reinhardtii and tobacco, and provides the most direct evidence of mutation effects in a native context.

Photosynthetic efficiency measurements using chlorophyll fluorescence techniques (PAM fluorometry) can quantify the functional consequences of atpF mutations. Parameters such as electron transport rate (ETR), non-photochemical quenching (NPQ), and the ratio of variable to maximum fluorescence (Fv/Fm) provide insights into different aspects of photosynthetic performance.

Blue Native PAGE followed by in-gel activity assays, similar to those used in studies of ATP synthase in other organisms , can directly correlate structural changes in the ATP synthase complex with functional alterations. This approach has demonstrated that disrupting peripheral stalk subunits can completely prevent ATP synthase assembly and function .

ATP synthesis rate measurements using biochemical assays with isolated thylakoids or purified ATP synthase complexes provide direct quantification of enzymatic activity. These measurements, when combined with structural analysis, establish clear structure-function relationships for different atpF domains.

How does atpF interact with proteolytic quality control systems in the chloroplast?

Chloroplast protein quality control is essential for maintaining functional photosynthetic machinery, with specific implications for ATP synthase assembly:

Chloroplast proteases, particularly FtsH proteases, play critical roles in ATP synthase subunit turnover. Studies in Chlamydomonas reinhardtii have shown that crossing ATP synthase mutants with protease mutants (ftsh1-1) identifies specific subunits as protease substrates and demonstrates that FtsH significantly contributes to the coordinated accumulation of ATP synthase subunits .

Pulse-chase experiments combined with immunoprecipitation can measure atpF turnover rates under different conditions or in various mutant backgrounds. This approach reveals how different quality control systems affect atpF stability and incorporation into the ATP synthase complex.

Protein aggregation assays using detergent-resistant fractionation or fluorescent protein fusions can determine whether mutated or unassembled atpF forms aggregates within the chloroplast. These aggregates would likely trigger quality control responses and subsequent degradation.

Protein interaction studies focusing on chaperones and proteases can identify which quality control components directly interact with atpF. Techniques such as co-immunoprecipitation followed by mass spectrometry can reveal these interactions, while in vitro reconstitution experiments can demonstrate direct effects of chaperones on atpF folding or proteases on atpF degradation.

Genetic approaches using mutants affecting different chloroplast quality control pathways can reveal which systems are primarily responsible for atpF turnover. Analysis of atpF accumulation and ATP synthase assembly in these mutants provides insights into the importance of quality control for proper complex formation.

What model systems are most appropriate for functional studies of Vitis vinifera atpF?

Selecting the appropriate model system is crucial for successful functional studies of Vitis vinifera atpF:

Escherichia coli complementation systems provide a straightforward approach for initial functional assessment. The atpF gene from Vitis vinifera can be introduced into E. coli strains lacking portions of their native ATP synthase genes, with functional complementation assessed by measuring growth on non-fermentable carbon sources. This approach has been successfully used for other ATP synthase subunits but has limitations due to differences between bacterial and chloroplast ATP synthase.

Chlamydomonas reinhardtii offers advantages as a photosynthetic model organism with established chloroplast transformation methods. Protocols for isolating and characterizing ATP synthase mutants, including those affecting peripheral stalk subunits, have been developed in this system . The relatively rapid growth and haploid genetics of C. reinhardtii facilitate functional studies.

Nicotiana tabacum (tobacco) provides a plant model with established chloroplast transformation protocols. While transformation is more time-consuming than in C. reinhardtii, tobacco more closely resembles grapevine in terms of plant physiology and chloroplast function. The larger size of tobacco plants also facilitates biochemical studies requiring substantial biomass.

Heterologous expression in Saccharomyces cerevisiae, particularly in yeast strains with altered mitochondrial ATP synthase, can be used to study specific aspects of atpF function. While yeast mitochondrial ATP synthase differs from chloroplast ATP synthase, certain functional properties and protein interactions may be conserved.

For high-resolution structural studies, recombinant expression in insect cells using baculovirus expression systems may provide advantages for producing correctly folded membrane proteins in higher yields than bacterial systems, facilitating crystallization or cryo-EM analysis.

The choice of model system should be guided by the specific research questions. For mechanistic studies of atpF function within the ATP synthase complex, photosynthetic organisms like C. reinhardtii or tobacco are preferred. For initial characterization of specific domains or interactions, bacterial or yeast systems may be more practical.

What controls should be included in experiments studying the effects of environmental stresses on atpF expression?

Control TypePurposeImplementation
Untreated controlsEstablish baseline expressionMaintain plants under optimal growth conditions
Time-matched controlsAccount for circadian/developmental effectsSample control plants at the same time points as treated plants
Recovery controlsDistinguish adaptive from damaging responsesReturn plants to control conditions after stress and monitor recovery
Gradient stress applicationDetermine threshold responsesApply stress at different intensities to establish dose-response relationships
Multiple stress controlsIdentify stress-specific vs. general responsesApply different stresses (e.g., light, temperature, drought) to the same genetic background
Alternative gene controlsDistinguish atpF-specific from general effectsMonitor expression of other ATP synthase subunits and unrelated chloroplast genes

When studying light stress effects, controls should include both quantity (intensity) and quality (spectrum) variations. For temperature stress, both the magnitude and rate of temperature change should be controlled. In drought stress experiments, careful monitoring of soil water content or leaf water potential is essential for reproducible results.

Measurements should include both transcript levels (qRT-PCR, RNA-seq) and protein levels (Western blotting, proteomics) to distinguish transcriptional from post-transcriptional effects. ATP synthase activity assays and measurements of photosynthetic parameters provide functional context for expression changes.

Statistical analysis should account for biological variability between individual plants and potential batch effects between experiments. Appropriate statistical tests and multiple test corrections should be applied when comparing multiple conditions or time points.

How should researchers design experiments to study atpF post-translational modifications?

Post-translational modifications (PTMs) can significantly impact atpF function, requiring specific experimental approaches:

Sample preparation is critical for preserving native PTMs. Rapid tissue harvest and processing in the presence of protease and phosphatase inhibitors helps maintain modification states. For redox-sensitive modifications, samples should be processed under anaerobic conditions or with alkylating agents to prevent artificial oxidation.

Mass spectrometry-based approaches provide the most comprehensive PTM identification. Bottom-up proteomics involving enzymatic digestion followed by LC-MS/MS analysis can identify specific modified residues. Enrichment strategies for phosphopeptides (IMAC, TiO2), glycopeptides (lectin affinity), or oxidatively modified peptides improve detection of less abundant modifications.

Targeted quantification using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) enables precise quantification of specific PTMs across multiple samples. These approaches are particularly valuable for time-course experiments or comparisons across different stress conditions.

Validation of PTM sites should employ site-directed mutagenesis to replace modified residues with either non-modifiable variants (e.g., Ser to Ala for phosphorylation sites) or modification mimics (e.g., Ser to Asp for phosphorylation). These mutants can be functionally characterized to determine the physiological significance of the modification.

Modification dynamics can be studied using pulse-chase approaches with isotopically labeled precursors or by time-course sampling following application of specific stimuli. These approaches reveal both the formation and turnover rates of modifications in response to environmental or developmental cues.

Integration with structural data, either experimental or predicted, helps place modifications in a functional context by identifying their locations relative to protein interaction surfaces or functional domains.

What approaches should be used to study atpF involvement in ATP synthase assembly intermediates?

ATP synthase assembly involves multiple intermediates, with atpF playing a key role in this process:

Pulse-chase labeling combined with immunoprecipitation provides a powerful approach for tracking assembly kinetics. By pulse-labeling newly synthesized proteins and following their incorporation into larger complexes over time, researchers can determine the order of assembly and identify rate-limiting steps.

Blue Native PAGE coupled with second-dimension SDS-PAGE can separate and identify assembly intermediates. This approach has been successfully used to study ATP synthase assembly in various organisms and can reveal how atpF contributes to different stages of complex formation.

Genetic approaches using inducible expression or depletion of atpF can directly test its requirement at different assembly stages. Systems where atpF expression can be temporally controlled allow researchers to determine whether it is needed for initiating assembly or stabilizing already-formed subcomplexes.

Crosslinking mass spectrometry (XL-MS) can capture transient interactions during assembly. By chemically crosslinking proteins in intact thylakoids at different time points during assembly, researchers can identify changing interaction patterns as the complex forms.

Cryo-electron microscopy of purified assembly intermediates provides structural insights into the assembly process. By purifying complexes at different assembly stages (using tagged subunits or separation based on size or density), researchers can visualize structural changes during assembly.

Comparison with known assembly pathways in model organisms provides valuable context. Studies in C. reinhardtii have demonstrated that peripheral stalk subunits are essential for ATP synthase accumulation , suggesting they play critical roles in the assembly process rather than being incorporated at later stages.

How should researchers analyze changes in ATP synthase complex integrity in atpF mutants?

Analysis of ATP synthase complex integrity in atpF mutants requires specialized approaches:

Blue Native PAGE followed by Western blotting or in-gel activity assays provides direct visualization of complex integrity. This approach can distinguish between complete absence of complexes, accumulation of subcomplexes, or altered migration of fully assembled complexes. In-gel ATPase activity assays, similar to those used in studies of ATP synthase in other organisms , directly correlate structural changes with functional consequences.

Quantitative proteomic analysis of purified thylakoid membranes can determine the stoichiometry of different ATP synthase subunits. Reduced levels of specific subunits may indicate instability and degradation when atpF is mutated. Label-free quantification or isobaric labeling approaches (TMT, iTRAQ) enable precise comparison across multiple samples.

Electron microscopy of isolated thylakoid membranes can visualize ATP synthase complexes in situ. Negative staining or cryo-EM approaches can reveal structural abnormalities in ATP synthase complexes containing mutated atpF. Immunogold labeling with antibodies against different subunits can confirm the presence or absence of specific components.

Functional assays measuring ATP synthesis rates, proton pumping, or ATP hydrolysis provide essential context for structural changes. Correlation between structural integrity and functional capacity helps determine which structural features are critical for activity.

Crosslinking studies can assess protein-protein interactions within partially assembled or destabilized complexes. By comparing crosslinking patterns between wild-type and mutant ATP synthase, researchers can identify which interactions are disrupted when atpF is altered.

Statistical analysis should include multiple biological replicates and appropriate normalization to account for differences in sample loading or membrane preparation. Multivariate statistical approaches may help identify patterns across multiple parameters measured.

How can researchers effectively integrate transcriptomic and proteomic data to understand atpF regulation?

Integration of transcriptomic and proteomic data provides a comprehensive view of atpF regulation:

Correlation analysis between transcript and protein levels is the first step in integration. Pearson or Spearman correlation coefficients quantify the relationship between these two levels of regulation. For atpF, discrepancies between transcript and protein levels may indicate post-transcriptional regulation or protein turnover effects.

Time-lagged correlation analysis can account for delays between transcription and translation. By shifting the time series data to find the maximum correlation, researchers can determine the temporal relationship between transcriptomic and proteomic changes.

Network-based integration approaches construct regulatory networks incorporating both transcript and protein data. These networks can identify regulatory hubs and feedback mechanisms that might not be apparent when analyzing each data type in isolation.

Multi-omics factor analysis (MOFA) or similar dimensionality reduction techniques designed for multi-omics data can identify major factors driving variation across both transcriptomic and proteomic datasets. This approach is particularly valuable for complex experimental designs with multiple conditions or time points.

Pathway-based integration focuses on biological pathways rather than individual genes or proteins. By analyzing coordinated changes in pathways related to photosynthesis, chloroplast development, or stress responses, researchers can place atpF regulation in a broader biological context.

Translation efficiency analysis calculates the ratio of protein to mRNA levels for each gene, providing insights into post-transcriptional regulation. Comparing translation efficiency of atpF with other chloroplast genes or nuclear-encoded ATP synthase subunits can reveal differential regulatory mechanisms.

Visualization tools such as integrated heatmaps or circos plots can effectively communicate complex relationships between transcriptomic and proteomic data, highlighting concordant and discordant patterns across different conditions or time points.

What approaches should be used to analyze the evolutionary conservation of atpF across plant species?

Evolutionary analysis of atpF provides insights into its structural and functional conservation:

Sequence alignment of atpF from multiple plant species is the foundation of evolutionary analysis. Multiple sequence alignment tools (MUSCLE, MAFFT, T-Coffee) can align sequences while accounting for insertions/deletions. Including diverse species from different plant lineages provides broader evolutionary context.

Phylogenetic tree construction using maximum likelihood, Bayesian, or distance-based methods visualizes evolutionary relationships. Tree visualization tools (iTOL, FigTree) can map additional data, such as functional annotations or structural features, onto the phylogeny.

Selection pressure analysis using dN/dS ratios (nonsynonymous to synonymous substitution rates) identifies regions under purifying, neutral, or positive selection. Tools like PAML or HyPhy can perform these analyses, revealing functionally important regions that resist evolutionary change.

Coevolution analysis identifies pairs of residues that evolve in a coordinated manner, often indicating functional or structural interactions. Methods such as mutual information analysis or direct coupling analysis can detect these coevolving residue pairs, providing insights into important structural constraints.

Synteny analysis examines the genomic context of atpF across species, revealing conservation or changes in gene order within the chloroplast genome. This approach can identify genomic rearrangements that might affect atpF regulation or expression.

Comparative analysis with bacterial homologs (from cyanobacteria or other bacteria with F-type ATP synthases) provides deeper evolutionary context, potentially revealing ancient conserved features dating back to the endosymbiotic origin of chloroplasts.

Plant GroupatpF IntronSequence Identity to Vitis viniferaSelection Pressure (dN/dS)Notable Features
Rosids (including Vitis)Present90-100%0.05-0.12 (strong purifying)Highly conserved transmembrane domain
AsteridsPresent85-90%0.08-0.15 (strong purifying)Minor variations in stromal domain
MonocotsPresent75-85%0.10-0.20 (purifying)Extended loops in stromal region
GymnospermsPresent70-80%0.12-0.25 (moderate purifying)Variations in N-terminal region
FernsVariable65-75%0.15-0.30 (moderate purifying)More variable stromal domain
MossesOften absent60-70%0.20-0.35 (relaxed purifying)Distinct N-terminal features
AlgaeOften absent50-65%0.25-0.45 (relaxed)Significant structural differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.