Recombinant Vitis vinifera CASP-like protein GSVIVT00013434001 (GSVIVT00013434001)

Shipped with Ice Packs
In Stock

Description

Overview of CASP-like Proteins in Vitis vinifera

CASP-like (Casparian strip membrane domain-like) proteins are integral membrane proteins involved in plant developmental processes and stress responses. These proteins are part of the MARVEL domain-containing family, critical for localized plasma membrane domain formation and cell wall modifications . In Vitis vinifera (grapevine), CASP-like proteins are associated with vascular tissue development and environmental stress tolerance, though their roles extend beyond Casparian strip formation in roots .

3.1. Role in Membrane Domain Formation

CASP-like proteins localize to plasma membranes and mediate domain-specific protein retention. For example:

  • AtCASP1 in Arabidopsis forms a membrane fence in root endodermal cells, restricting diffusion of membrane proteins and lipids .

  • VvCASPL3A1 (GSVIVT00034332001) shares structural homology with CASP proteins, suggesting analogous roles in Vitis vinifera .

3.2. Stress Response and Cold Tolerance

Studies on CASPL homologs in other species reveal conserved stress-related functions:

  • ClCASPL in watermelon (Citrullus lanatus) and AtCASPL4C1 in Arabidopsis negatively regulate cold tolerance. Knockout mutants exhibit enhanced growth and stress resilience .

  • Transcript levels of CASPL genes in Vitis vinifera are upregulated under abiotic stresses, hinting at similar regulatory mechanisms .

3.3. Vascular Tissue Development

CASP-like proteins are expressed in vascular tissues and floral organs, influencing growth dynamics:

  • AtCASPL4C1 overexpression delays flowering and reduces biomass, while knockouts accelerate growth .

  • In Vitis vinifera, CASPLs are linked to lignin deposition and xylem differentiation, critical for disease resistance .

4.1. Recombinant Expression

  • Expression System: E. coli (strain GV1301) .

  • Purification: Affinity chromatography using His tag .

  • Applications:

    • Structural studies of transmembrane domains .

    • Functional assays to elucidate roles in membrane trafficking and stress signaling .

4.2. Research Limitations

  • Functional Redundancy: CASPL genes show redundancy, complicating phenotype analysis in single mutants .

  • Localization Challenges: Membrane-bound nature requires advanced imaging techniques (e.g., confocal microscopy) for subcellular studies .

Evolutionary and Phylogenetic Insights

  • Conservation: CASPLs share homology with MARVEL domain proteins in fungi and animals, indicating ancient evolutionary origins .

  • Taxonomic Distribution: CASPLs are absent in non-vascular plants (e.g., Physcomitrella patens) but present in angiosperms with Casparian strips .

Future Research Directions

  • Mechanistic Studies: Elucidate how transmembrane domains mediate protein localization and interaction.

  • Biotechnological Applications: Engineer CASPL variants to enhance stress tolerance in crops .

References

  1. UniProt entry A7P756 (VvCASPL3A1) .

  2. Functional analysis of CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS .

  3. Role of CASPL in cold tolerance and growth regulation .

  4. Structural characterization of grapevine VPEs and PRR proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GSVIVT00013434001; CASP-like protein 1C1; VvCASPL1C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
GSVIVT00013434001
Target Protein Sequence
MAKIKRIITTLVRLLVLGAALSATIVMVTSHDSAEVLNLSFDAKYTNARAFVYFAITNAI ASGYSFIALFLSFSTPLWHLVFLLDVFMTLLLTSSISVALAIADVGKKGNSHAGWLPVCG QVPEFCDHVTGALIAGFSAAVLYLVLLLFSIHAVLNPKP
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of GSVIVT00013434001 and how does it compare to other CASP-like proteins?

GSVIVT00013434001 belongs to the CASP-like (CASPL) protein family, characterized by four transmembrane spans. Based on structural analyses of CASP proteins, it likely forms a membrane scaffold similar to other CASPLs. The protein contains transmembrane domains that are highly conserved across plant species, with the second extracellular loop (EL2) showing significant conservation while the first extracellular loop (EL1) typically exhibits lower conservation .

In membrane localization experiments, CASPLs demonstrate high stability in their membrane domains, which suggests that GSVIVT00013434001 likely forms a stable transmembrane scaffold. The protein would be expected to localize to the plasma membrane, as demonstrated with other CASP-like proteins such as ClCASPL from watermelon .

How can I determine if GSVIVT00013434001 contains the conserved nine-amino acid signature found in other CASP proteins?

To determine if GSVIVT00013434001 contains the conserved nine-amino acid signature (ESLPFFTQF) found in some CASP proteins, implement the following methodological approach:

  • Perform a multiple sequence alignment of GSVIVT00013434001 with confirmed CASP proteins that possess this signature

  • Specifically examine the first extracellular loop (EL1) region where this signature is typically located

  • Use alignment tools such as Clustal Omega or MUSCLE for the analysis

  • Confirm findings through site-directed mutagenesis experiments

The presence of this signature could indicate functional similarity to CASPs found in spermatophytes, which are specifically involved in endodermal function. Its absence might suggest divergent functionality more similar to general CASPLs found across broader plant lineages .

What are the predicted post-translational modifications of GSVIVT00013434001?

While specific post-translational modifications of GSVIVT00013434001 have not been directly characterized in the literature, analysis of CASP-like proteins suggests several potential modifications:

Modification TypePrediction ToolsSignificance
PhosphorylationNetPhos, PhosphoSiteMay regulate membrane domain stability
GlycosylationNetNGlyc, NetOGlycPotentially affects protein-protein interactions
S-palmitoylationCSS-PalmMay influence membrane association
UbiquitinationUbPredCould regulate protein turnover

Experimental validation of these predictions would require mass spectrometry analysis of purified protein, with and without phosphatase treatment, combined with site-directed mutagenesis of predicted modification sites .

What is the tissue-specific expression pattern of GSVIVT00013434001 in Vitis vinifera?

Based on expression patterns observed for other CASP-like proteins, GSVIVT00013434001 likely shows tissue-specific expression that corresponds to its physiological function. Studies of orthologous CASP-like proteins demonstrate that promoter analysis using reporter genes (such as GUS or fluorescent proteins) can effectively map expression patterns.

For example, the Arabidopsis ortholog AtCASPL4C1 is widely expressed across various organs and is inducible under cold stress conditions . To determine the specific expression pattern of GSVIVT00013434001:

  • Clone the 2kb upstream region of GSVIVT00013434001

  • Create a promoter-reporter fusion construct (using GUS or fluorescent protein)

  • Transform Vitis vinifera tissues or use heterologous expression in Arabidopsis

  • Analyze tissue sections at different developmental stages and under various stress conditions

This approach would provide a comprehensive understanding of when and where GSVIVT00013434001 is expressed in grapevine tissues .

How can I verify the subcellular localization of GSVIVT00013434001?

To verify the subcellular localization of GSVIVT00013434001, implement this methodological workflow:

  • Create a C-terminal or N-terminal fusion with a fluorescent protein (GFP, mCherry)

  • Express the fusion protein in:

    • Heterologous systems (tobacco leaves via Agrobacterium-mediated transformation)

    • Vitis vinifera cell suspensions

    • Arabidopsis as a model system

  • Analyze using confocal microscopy alongside appropriate membrane markers

  • Perform co-localization experiments with known plasma membrane markers

  • Conduct cellular fractionation followed by Western blot analysis as biochemical confirmation

Based on findings from other CASP-like proteins, GSVIVT00013434001 would be expected to localize to the plasma membrane. For example, ClCASPL-GFP from watermelon was found to localize in the plasma membrane , suggesting that GSVIVT00013434001 would behave similarly .

What experimental design would best determine if GSVIVT00013434001 functions in stress response?

To determine if GSVIVT00013434001 functions in stress response, particularly cold stress as suggested by studies of orthologous proteins, implement the following experimental design:

Experimental ApproachMethodologyMeasurementsControls
Gene expression analysisqRT-PCR under various stress conditionsExpression fold changeHousekeeping genes
Overexpression studiesGenerate transgenic plants overexpressing GSVIVT00013434001Growth parameters, stress toleranceEmpty vector controls
Knockout/knockdownCRISPR-Cas9 or RNAi targeting GSVIVT00013434001Phenotypic analysis, stress sensitivityWild-type and off-target controls
Complementation assaysExpress in Arabidopsis AtCASPL4C1 mutantsRestoration of wild-type phenotypeEmpty vector transformed mutants

This multi-faceted approach would provide robust evidence for stress response function. The experimental design should include at least three biological replicates and appropriate statistical analysis. Based on findings for AtCASPL4C1, which showed altered cold tolerance when knocked out , you might expect GSVIVT00013434001 to similarly influence stress responses in grapevine .

How should I design experiments to investigate protein-protein interactions involving GSVIVT00013434001?

To investigate protein-protein interactions involving GSVIVT00013434001, follow this comprehensive experimental approach:

  • In vitro methods:

    • Pull-down assays using purified recombinant GSVIVT00013434001

    • Co-immunoprecipitation from plant extracts using specific antibodies

  • In vivo methods:

    • Yeast two-hybrid screening against a Vitis vinifera cDNA library

    • Split-ubiquitin membrane yeast two-hybrid for membrane protein interactions

    • Bimolecular Fluorescence Complementation (BiFC) in planta

    • Förster Resonance Energy Transfer (FRET) analysis

  • Mass spectrometry approaches:

    • Proximity-dependent biotin identification (BioID)

    • Tandem affinity purification coupled with mass spectrometry

Given that CASP proteins form membrane domains and interact with lignin polymerization machinery in Arabidopsis , focus on investigating interactions with cell wall modification enzymes and other membrane proteins. This approach will help determine if GSVIVT00013434001 participates in similar protein complexes in grapevine .

What variables must be controlled when analyzing the effects of GSVIVT00013434001 overexpression in transgenic plants?

When analyzing the effects of GSVIVT00013434001 overexpression in transgenic plants, the following variables must be carefully controlled:

Variable CategorySpecific VariablesControl Method
Genetic factorsInsertion position effectsGenerate multiple independent lines
Copy number variationSouthern blot or qPCR verification
Expression levelqRT-PCR quantification
Environmental factorsTemperatureGrowth chambers with precise control
Light intensity and photoperiodStandardized lighting conditions
Water and nutrient availabilityRegulated irrigation and fertilization
Developmental factorsGrowth stage at analysisAge-matched plants
Tissue selectionStandardized sampling procedures
Experimental controlsNegative controlsEmpty vector transformants
Positive controlsKnown phenotype transformants
Wild-type controlsSame genetic background

Based on studies of other CASP-like proteins, particular attention should be paid to growth parameters, flowering time, and stress responses, as these were significantly altered in AtCASPL4C1 knockout lines . This comprehensive approach ensures reliable data interpretation and minimizes experimental artifacts .

How can CRISPR-Cas9 genome editing be optimized for studying GSVIVT00013434001 function in Vitis vinifera?

Optimizing CRISPR-Cas9 genome editing for studying GSVIVT00013434001 function in Vitis vinifera requires addressing several grape-specific challenges:

  • sgRNA design considerations:

    • Target conserved regions within exons, particularly in the transmembrane domains

    • Design multiple sgRNAs targeting different exons

    • Verify specificity against the Vitis vinifera genome to minimize off-target effects

    • Optimize for grapevine codon usage

  • Delivery method optimization:

    • Agrobacterium-mediated transformation of embryogenic calli

    • Protoplast transformation for initial validation

    • Ribonucleoprotein (RNP) complex delivery to reduce off-target effects

  • Selection and verification:

    • Design PCR-based screening for detecting indels

    • Implement T7 endonuclease assay or TIDE analysis

    • Sequence verification of mutations

    • RT-qPCR and Western blot confirmation of knockout

  • Phenotypic analysis:

    • Focus on stress tolerance parameters based on findings with AtCASPL4C1

    • Examine growth rate, biomass, and flowering time

    • Analyze membrane domain formation using fluorescent markers

This methodical approach will help overcome the difficulties of grapevine transformation while providing robust functional data on GSVIVT00013434001 .

What are the most appropriate heterologous expression systems for producing recombinant GSVIVT00013434001 for structural studies?

For structural studies of recombinant GSVIVT00013434001, consider these heterologous expression systems, each offering specific advantages:

Expression SystemAdvantagesLimitationsPurification Strategy
E. coliHigh yield, rapid growthMay form inclusion bodiesDetergent solubilization, IMAC purification
Yeast (P. pastoris)Post-translational modifications, membrane targetingLonger cultivation timeAffinity chromatography with membrane preparation
Insect cellsMammalian-like glycosylation, proper foldingHigher cost, complex cultivationBaculovirus expression, membrane isolation
Plant-based systemsNative environment for foldingLower yield, time-consumingTransient expression in N. benthamiana

For membrane proteins like GSVIVT00013434001, insect cell or plant-based expression systems often provide better structural integrity. Since transmembrane domains are crucial for CASP protein function , careful detergent selection during purification is essential to maintain the native conformation. Consider implementing Styrene Maleic Acid Lipid Particles (SMALPs) for membrane extraction to preserve the lipid environment .

How might comparative genomics inform the evolution of GSVIVT00013434001 function across plant species?

Comparative genomics provides valuable insights into the evolution of GSVIVT00013434001 function through these methodological approaches:

  • Phylogenetic analysis:

    • Construct phylogenetic trees including CASP and CASPL proteins from diverse plant species

    • Map the emergence of key functional domains, particularly the nine-amino acid signature (ESLPFFTQF) found in spermatophyte CASPs

    • Examine selection pressure on different protein domains using dN/dS ratios

  • Synteny analysis:

    • Investigate genomic context conservation around GSVIVT00013434001 orthologs

    • Identify co-evolved gene clusters that might indicate functional relationships

  • Domain architecture comparison:

    • Analyze conservation of transmembrane domains and loop regions

    • Identify lineage-specific insertions/deletions that might confer specialized functions

  • Expression pattern evolution:

    • Compare expression profiles of orthologs across species

    • Identify regulatory element conservation or divergence

Based on existing research, CASP-like proteins are found across all major divisions of land plants and green algae, with CASP proteins proper (containing the nine-amino acid signature) appearing more recently in spermatophytes . This evolutionary trajectory suggests that GSVIVT00013434001 might represent an adaptation specific to vascular plants, potentially related to specialized membrane domain formation or stress response functions .

What are common pitfalls when expressing membrane proteins like GSVIVT00013434001 in heterologous systems?

When expressing membrane proteins like GSVIVT00013434001 in heterologous systems, researchers frequently encounter these challenges and solutions:

ChallengeManifestationSolution Approach
Protein misfoldingLow functional yield, aggregationUse fusion tags (MBP, SUMO); lower expression temperature
Toxicity to hostPoor growth, plasmid instabilityUse tightly regulated inducible promoters; leak-free expression systems
Improper membrane insertionIncorrect localization, inclusion bodiesInclude proper signal sequences; optimize membrane targeting
Post-translational modification differencesAltered glycosylation, phosphorylationSelect expression systems with similar PTM machinery
Low expression levelsInsufficient protein for analysisCodon optimization; use stronger promoters; scale up culture
Protein degradationMultiple bands on Western blotAdd protease inhibitors; optimize extraction buffer composition
Detergent selection issuesLoss of function during purificationScreen multiple detergents; consider nanodiscs or SMALPs

For CASP-like proteins specifically, mutagenesis studies have shown that certain conserved residues in transmembrane domains (such as the Asp residue in TM3) may be essential for correct protein folding . Therefore, preserving these critical residues during construct design is essential .

How can I resolve data inconsistencies when comparing GSVIVT00013434001 knockout phenotypes with overexpression studies?

Resolving data inconsistencies between knockout and overexpression studies requires a systematic troubleshooting approach:

  • Verify genetic modifications:

    • Confirm knockout is complete through genomic PCR, RT-PCR, and Western blotting

    • Quantify overexpression levels across independent lines

    • Ensure no compensatory expression of homologous genes

  • Address dosage effects:

    • Generate and analyze multiple independent transgenic lines with varying expression levels

    • Create an expression gradient using inducible promoters

    • Consider dominant-negative effects in overexpression lines

  • Examine developmental timing:

    • Conduct time-course analyses to distinguish immediate vs. long-term effects

    • Implement tissue-specific or inducible systems to bypass developmental adaptations

  • Control for genetic background:

    • Use identical background for both knockout and overexpression

    • Perform complementation tests to confirm phenotype causality

  • Consider protein interactions:

    • Overexpression may sequester interacting partners

    • Knockout may destabilize protein complexes

Based on studies of AtCASPL4C1, knockout lines showed opposite phenotypes to overexpression lines regarding cold tolerance , suggesting a negative regulatory role. Similar opposing effects might be expected with GSVIVT00013434001, where inconsistencies could actually reflect biological reality rather than experimental error .

What strategies can overcome challenges in analyzing membrane domain formation by GSVIVT00013434001?

Analyzing membrane domain formation by GSVIVT00013434001 presents unique challenges that can be addressed through these specialized approaches:

  • Advanced microscopy techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize domains below diffraction limit

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Single-particle tracking to analyze dynamic behavior

    • Total Internal Reflection Fluorescence (TIRF) microscopy for improved membrane visualization

  • Membrane isolation strategies:

    • Detergent-resistant membrane fractionation

    • Density gradient centrifugation to isolate membrane microdomains

    • Atomic Force Microscopy of isolated membranes

  • Protein-lipid interaction analysis:

    • Lipidomics of membrane domains containing GSVIVT00013434001

    • In vitro reconstitution with defined lipid compositions

    • Lipid binding assays to identify specific interactions

  • Functional probes for domain integrity:

    • Fluorescent lipid analogs to test barrier function

    • Electrophysiology measurements across membranes

    • Protein diffusion analyses using photo-switchable fluorescent proteins

CASP proteins form membrane scaffolds that can restrict diffusion of other membrane components . Therefore, measuring the diffusion barriers created by GSVIVT00013434001 would provide functional evidence of domain formation, similar to how the Casparian strip membrane domain restricts diffusion in plant endodermis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.