Recombinant Vitis vinifera CASP-like protein 2B1 (GSVIVT00013502001)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Catalog Number: RFL30030VF
Source: Expressed in Escherichia coli with N-terminal His-tag for purification
Species Origin: Vitis vinifera (Grape)
UniProt ID: A7R385
Synonyms: VvCASPL2B1, CASP-like protein 2B1

Functional and Contextual Insights

CASP-like proteins are implicated in plant membrane organization and nutrient transport. While GSVIVT00013502001’s exact biological role remains uncharacterized, homologs like VvCASPL1C1 (GSVIVT00013434001) and VIT_05s0020g01820 (A7NW78) suggest involvement in:

  • Cell wall biosynthesis

  • Stress response pathways

Comparative CASP-like Proteins in Vitis vinifera:

Protein IDUniProt IDLength (aa)Key Features
GSVIVT00013502001A7R385202Full-length, His-tagged
GSVIVT00013434001A7R333159Expressed in E. coli
VIT_05s0020g01820A7NW78195Tris/glycerol storage buffer

Research Applications

  • Protein-Protein Interaction Studies: Suitable for yeast two-hybrid, co-IP, or pull-down assays (methodology noted in , though specific interactors are undefined).

  • Structural Biology: Full-length sequence enables crystallization or cryo-EM trials .

  • Antibody Production: His-tag allows antibody generation for immunolocalization .

Limitations and Future Directions

  • Pathway Data: No experimentally validated pathways are currently linked to GSVIVT00013502001 .

  • Functional Gaps: Biochemical activities (e.g., enzymatic or transport functions) require empirical validation.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format preference, please indicate your requirement in the order notes. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
GSVIVT00013502001; CASP-like protein 2B1; VvCASPL2B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
GSVIVT00013502001
Target Protein Sequence
MSYLGVGVSPGNVPVYHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIF TIQKKAKFTDMKALVFLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQV IAYLTLAAVAAAAQSSVFGEFGQPELQWMKICNMYGKFCNQVGEGIVSAVGVSLSMVILS GISAFSLFRLYGGNKGTSGGRW
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure of Vitis vinifera CASP-like protein 2B1 and how does it relate to other CASP family proteins?

Vitis vinifera CASP-like protein 2B1 likely follows the canonical CASP structure with four transmembrane domains, cytoplasmic N and C termini, variable N-terminus length, short C-terminus, and a short intracellular loop. The protein would exhibit high conservation in the first (TM1) and third (TM3) transmembrane domains, with an Arginine residue in TM1 and an Aspartic acid in TM3, which are conserved in most CASP-like proteins .

The protein belongs to the broader family of CASP and CASP-like (CASPL) proteins found throughout the plant kingdom. Like other members of this family, it is likely a member of the MARVEL protein family, which shows high similarity in transmembrane domains but not necessarily in extracellular or intracellular exposed regions . Phylogenetic analysis would be required to determine its precise relationship to the CASP1-5 proteins characterized in Arabidopsis that are known to mediate Casparian strip formation.

How can researchers experimentally determine the transmembrane topology of Vitis vinifera CASP-like protein 2B1?

Methodological approach:

  • Fusion protein analysis: Generate N-terminal and C-terminal GFP fusion constructs and express in plant cells. Protease protection assays can determine cytoplasmic exposure.

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and use membrane-impermeable thiol-reactive reagents to determine accessibility.

  • Split-GFP complementation: Fuse fragments of GFP to different domains and assess fluorescence recovery based on subcellular localization.

  • Protease susceptibility testing: Express the protein with epitope tags in different domains and assess susceptibility to proteases in membrane preparations.

A robust experimental design would combine these approaches with computational predictions based on hydrophobicity analysis to establish a consensus model of membrane topology.

What is the predicted tissue-specific expression pattern of Vitis vinifera CASP-like protein 2B1?

Experimental approach to determine expression pattern:

  • RNA isolation from different grapevine tissues followed by quantitative RT-PCR analysis

  • Generation of promoter-reporter constructs (e.g., promoter:GUS) and transformation into grapevine or heterologous systems

  • In situ hybridization to visualize mRNA localization in tissue sections

  • Immunohistochemistry using specific antibodies if available

Researchers should consider both developmental stages and environmental conditions, as some CASP-like proteins show stress-responsive expression patterns, such as cold induction .

How does membrane domain formation by Vitis vinifera CASP-like protein 2B1 compare with other characterized CASP proteins?

Experimental design to address this question:

  • Generate fluorescent protein fusions (e.g., CASP-like 2B1-GFP) and express in appropriate plant cells

  • Track protein dynamics using time-lapse confocal microscopy to observe:

    • Initial targeting to the plasma membrane

    • Formation of stable membrane domains

    • Protein turnover rates within these domains

  • Compare with known CASP proteins:

    • Lateral diffusion rates using FRAP (Fluorescence Recovery After Photobleaching)

    • Co-localization with known membrane domain markers

    • Barrier properties of formed domains using fluorescent tracers

The expected behavior, based on characterized CASPs, would include initial targeting to the whole plasma membrane, followed by localized enrichment and removal from lateral membranes, resulting in an extremely low protein turnover at specific membrane domains .

What experimental approaches can determine if Vitis vinifera CASP-like protein 2B1 is involved in Casparian strip formation?

Comprehensive methodological approach:

  • Complementation studies: Express Vitis vinifera CASP-like protein 2B1 in Arabidopsis casp mutants under the control of CASP1 promoter and assess rescue of Casparian strip formation using:

    • Propidium iodide penetration assays to test barrier function

    • Lignin staining (basic fuchsin or berberine-aniline blue) to visualize Casparian strips

    • Transmission electron microscopy to examine ultrastructure

  • Localization analysis: Create fluorescent protein fusions to determine if the protein localizes to the Casparian strip membrane domain (CSD) when expressed in the endodermis

  • Interaction studies: Test for interactions with known Casparian strip formation machinery components:

    • Peroxidases that mediate lignin deposition

    • ESB1 (ENHANCED SUBERIN 1)

    • Other CASP proteins using co-immunoprecipitation or BiFC (Bimolecular Fluorescence Complementation)

  • CRISPR/Cas9-mediated mutagenesis in grapevine to assess native function

The approach should consider the possibility of redundancy among CASP family members, as single mutants often show mild or no phenotypes due to functional compensation .

How might extracellular loops contribute to Vitis vinifera CASP-like protein 2B1 function?

Interestingly, studies with AtCASP1 have shown that extracellular loops are dispensable for localization at the Casparian strip membrane domain (CSD), even though mutations of individual residues in these loops can affect localization to varying degrees .

Experimental approach to test extracellular loop function:

  • Generate deletion variants lacking either the first extracellular loop (EL1) or second extracellular loop (EL2)

  • Create point mutations in conserved residues within these loops

  • Express these variants as fluorescent fusion proteins and assess:

    • Localization to membrane domains

    • Temporal dynamics of domain formation

    • Stability of the protein at the membrane

    • Ability to interact with cell wall modification machinery

Special attention should be paid to the nine-amino acid signature in EL1 (if present), as this is associated with endodermis-specific function in other CASP proteins .

What role might Vitis vinifera CASP-like protein 2B1 play in cold stress responses?

Evidence from watermelon (Citrullus lanatus) showed that a cold-induced CASP-like protein (ClCASPL) negatively altered growth and temperature stress responses . Its ortholog in Arabidopsis (AtCASPL4C1) was also cold-inducible, and knock-out plants displayed elevated tolerance to cold stress while overexpression of ClCASPL increased cold sensitivity .

Methodological approach to investigate cold stress response:

  • Expression analysis:

    • qRT-PCR analysis of Vitis vinifera CASP-like protein 2B1 expression under various cold treatment regimes

    • Promoter-reporter assays to visualize tissue-specific cold induction patterns

  • Functional analysis:

    • Generate transgenic grapevine or Arabidopsis plants with altered expression levels

    • Assess cold tolerance parameters:

      • Electrolyte leakage

      • Chlorophyll fluorescence (Fv/Fm ratio)

      • ROS accumulation

      • Cold-responsive gene expression

  • Physiological measurements:

    • Membrane integrity under cold stress

    • Water transpiration rates

    • Nutrient uptake efficiency

This characterization would help determine if the protein functions as a negative regulator of cold tolerance, similar to ClCASPL .

How does Vitis vinifera CASP-like protein 2B1 expression correlate with nutrient homeostasis?

CASP proteins can play important roles in nutrient homeostasis through their function in forming diffusion barriers in roots. For example, OsCASP1 in rice has been implicated in nutrient homeostasis and adaptation to growth environments .

Research approach:

  • Nutrient availability experiments:

    • Grow grapevines under various nutrient regimes (deficiency, sufficiency, excess)

    • Measure Vitis vinifera CASP-like protein 2B1 expression levels

    • Correlate with nutrient uptake and distribution parameters

  • Comparison of root barrier properties:

    • Using fluorescent tracer dyes to assess apoplastic barriers

    • Measuring radial transport of nutrients in plants with altered expression

    • Analysis of suberin and lignin deposition patterns

  • Data analysis and modeling:

    • Create a correlation matrix between expression levels and physiological parameters

    • Develop predictive models for nutrient uptake based on expression patterns

    • Compare with known data from other CASP proteins

Nutrient ConditionCASPL ExpressionRoot Barrier StatusPredicted Physiological Impact
Nitrogen deficiency↑ or ↓Enhanced or reducedAltered N uptake efficiency
Phosphorus limitationTo be determinedTo be determinedPotential adaptation mechanism
Salt stressTo be determinedTo be determinedIon exclusion or retention

What protein-protein interactions are critical for Vitis vinifera CASP-like protein 2B1 function?

Based on known CASP protein interactions, several potential interaction partners might be investigated:

Methodological approach for interaction mapping:

  • Yeast two-hybrid screening using the cytoplasmic domains as bait against a grapevine cDNA library

  • Co-immunoprecipitation followed by mass spectrometry to identify interacting proteins in planta

  • Proximity-dependent labeling using BioID or TurboID fusions to identify proteins in the vicinity

  • Split-ubiquitin assays specifically designed for membrane protein interactions

Potential interaction partners to investigate include:

  • Other CASP or CASP-like proteins that might form heteromeric complexes

  • Lignin biosynthetic enzymes, particularly peroxidases

  • MYB transcription factors analogous to MYB36 in Arabidopsis, which controls CASP expression

  • LOTR1 (LORD OF THE RINGS 1), a putative extracellular protease crucial for CSD positioning

How can researchers distinguish between direct and indirect effects when analyzing Vitis vinifera CASP-like protein 2B1 mutant phenotypes?

Advanced research design approach:

  • Construct development:

    • Generate tissue-specific and inducible expression systems

    • Create chimeric proteins with domains from different CASP-like proteins

  • Multi-level phenotyping:

    • Transcriptome analysis at different time points after induction

    • Metabolomic profiling to identify early vs. late changes

    • Time-course microscopy to establish sequence of cellular events

  • Epistasis analysis:

    • Generate double mutants with genes in potentially related pathways

    • Use pharmacological inhibitors to block specific cellular processes

    • Employ cell type-specific CRISPR interference for temporal control

  • Data integration and modeling:

    • Develop causal network models

    • Use Bayesian statistical approaches to assess probability of direct vs. indirect effects

    • Validate models with targeted interventions

This approach addresses a common challenge in functional genomics where distinguishing primary from secondary effects requires careful experimental design and statistical analysis.

What are the optimal conditions for heterologous expression of functional Vitis vinifera CASP-like protein 2B1?

Methodological considerations for recombinant production:

  • Expression system selection:

    • Bacterial systems (E. coli): May require fusion partners (MBP, SUMO) to enhance solubility

    • Yeast systems (Pichia pastoris): Better for membrane protein expression

    • Insect cell systems: Suitable for complex eukaryotic proteins

    • Plant expression systems: Cell-free wheat germ or transient expression in Nicotiana benthamiana

  • Optimization parameters:

    • Temperature: Lower temperatures (16-20°C) often improve folding

    • Induction conditions: Concentration and timing of inducer addition

    • Media composition: Supplements that stabilize membrane proteins

    • Solubilization strategies: Detergent screening or nanodiscs

  • Purification approach:

    • Affinity tags placement (N-terminal vs. C-terminal)

    • Detergent exchange during purification

    • On-column refolding if necessary

  • Quality control methods:

    • Size-exclusion chromatography to assess oligomeric state

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays

For functional studies, maintaining the native transmembrane topology and ensuring proper folding present particular challenges that require careful optimization.

How can researchers resolve contradictory data between in vitro and in vivo studies of Vitis vinifera CASP-like protein 2B1?

Advanced research problem-solving framework:

  • Systematic comparison:

    • Create a detailed table of contradictory findings

    • Analyze methodological differences that might explain discrepancies

    • Identify biological contexts that differ between systems

  • Bridging experiments:

    • Design intermediate systems (e.g., semi-in vivo assays)

    • Use reconstitution approaches with increasing complexity

    • Develop cell-free expression systems with native membranes

  • Validation strategies:

    • Independent methodological approaches to test the same hypothesis

    • Time-resolved studies to capture dynamic processes

    • Single-molecule techniques to address population heterogeneity

  • Computational integration:

    • Develop models that can accommodate seemingly contradictory data

    • Use machine learning to identify hidden variables

    • Employ sensitivity analysis to determine critical parameters

This framework enables researchers to reconcile discrepancies that commonly arise between reconstituted systems, heterologous expression, and native functional contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.