Recombinant Vitis vinifera CASP-like protein VIT_01s0010g01870 (VIT_01s0010g01870)

Shipped with Ice Packs
In Stock

Description

Identification and Classification

The VIT_01s0010g01870 protein has been classified through multiple identification systems, providing a comprehensive framework for its categorization in various databases and research contexts:

Identifier TypeDesignation
Gene NameVIT_01s0010g01870
UniProt IDA7QBZ2
SynonymsGSVIVT00035166001, GSVIVT01010256001, VIT_00010256001, Vv01s0010g01870, CASP-like protein 2A1, VvCASPL2A1

This protein has been classified within the broader CASP-like protein family, specifically designated as a CASP-like protein 2A1 (VvCASPL2A1), indicating its subcategorization within the larger family of CASP-related proteins .

Production and Purification of Recombinant VIT_01s0010g01870

The recombinant VIT_01s0010g01870 protein is produced through heterologous expression in Escherichia coli bacterial systems, which allows for high-yield production of the protein for research and commercial applications .

Expression System and Preparation

The recombinant protein is expressed in E. coli bacterial systems with an N-terminal histidine tag to facilitate purification through affinity chromatography techniques. The expressed protein encompasses the full 205 amino acid sequence of the native Vitis vinifera protein .

Membrane Domain Organization

CASP-like proteins serve as critical components in the formation of specialized membrane domains. The founding members of the CASP protein family (CASP1-5) are known to mediate Casparian strip formation in plant roots, which creates essential diffusion barriers that regulate water and nutrient uptake .

Expanded Functional Roles Beyond Root Tissues

Recent research on CASP-like proteins in other plant species, such as watermelon (Citrullus lanatus) and Arabidopsis thaliana, suggests that these proteins have more diverse functions than initially understood. For example, studies of the orthologous AtCASPL4C1 gene in Arabidopsis demonstrate that CASP-like proteins may play significant roles in:

  • Cold stress response mechanisms

  • Regulation of plant growth and development

  • Biomass accumulation and flowering time

  • Vascular tissue organization beyond the Casparian strip in roots

These findings suggest that VIT_01s0010g01870 in Vitis vinifera may similarly contribute to multiple physiological processes beyond the traditional understanding of CASP protein functions.

Comparative Analysis with Other CASP-like Proteins

The Vitis vinifera genome encodes multiple CASP-like proteins, suggesting functional diversification within this protein family in grapevine species.

CASP-like Protein Diversity in Vitis vinifera

Available catalog information indicates that several distinct CASP-like proteins have been identified in Vitis vinifera:

Catalog NumberProtein Name
RP18949CASP-like protein VIT_01s0010g01870
RP18950CASP-like protein VIT_05s0020g01820
RP18952CASP-like protein GSVIVT00013502001
RP18953Casparian strip membrane protein VIT_08s0007g02880
RP18954CASP-like protein VIT_14s0068g01400
RP18955Casparian strip membrane protein VIT_06s0080g00840
RP18957CASP-like protein VIT_10s0092g00220
RP18958CASP-like protein VIT_07s0104g01350
RP18960CASP-like protein VIT_12s0028g03760

This diversity suggests specialized roles for different CASP-like proteins within various tissues and developmental contexts in grapevine .

Insights from Orthologous CASP-like Proteins

Studies of CASP-like proteins in other plant species provide valuable insights into potential functions of VIT_01s0010g01870. For instance, research on the watermelon ClCASPL and Arabidopsis AtCASPL4C1 proteins has revealed:

  • Plasma membrane localization, consistent with expected CASP protein distribution

  • Cold-inducible expression patterns

  • Involvement in growth regulation, with knockout plants showing faster growth and increased biomass

  • Functional roles in cold stress tolerance, with modulation of CASP-like protein expression affecting plant response to cold conditions

These findings suggest potential similar roles for VIT_01s0010g01870 in grapevine biology, particularly in environmental stress responses and growth regulation.

Research Applications and Significance

The recombinant VIT_01s0010g01870 protein represents a valuable research tool for investigating multiple aspects of plant biology.

Potential Research Applications

The availability of high-purity recombinant VIT_01s0010g01870 enables diverse research applications:

  • Structural studies to understand protein-protein interactions in membrane domains

  • Functional analysis of CASP-like protein roles in grapevine development

  • Investigation of cold tolerance mechanisms in commercial grape varieties

  • Comparative studies across different plant species to understand evolutionary conservation of CASP protein functions

  • Development of novel strategies for improving grape cultivation under adverse environmental conditions

Agricultural and Biotechnological Significance

Understanding the function of VIT_01s0010g01870 has potential implications for grapevine cultivation and improvement:

  • Insights into cold tolerance mechanisms could facilitate development of more resilient grape varieties

  • Understanding of growth regulation could contribute to improved agricultural productivity

  • Knowledge of membrane domain organization may provide targets for enhancing water and nutrient utilization efficiency

  • Potential applications in metabolic engineering to enhance grape quality characteristics

Current Research Limitations and Future Directions

Despite the available information on VIT_01s0010g01870, several research gaps remain to be addressed.

Research Limitations

Current understanding of VIT_01s0010g01870 is limited by:

  • Lack of grapevine-specific functional studies focused on this particular protein

  • Limited characterization of tissue-specific expression patterns in Vitis vinifera

  • Incomplete understanding of protein interaction partners and regulatory networks

  • Insufficient information on how environmental factors affect VIT_01s0010g01870 expression and function

Future Research Directions

Future studies should address these limitations through:

  • Comprehensive expression profiling across different grapevine tissues and developmental stages

  • Creation and characterization of knockout or overexpression lines in grapevine

  • Proteomics approaches to identify interaction partners

  • Structural studies to understand membrane integration and protein-protein interactions

  • Field trials to assess impacts of VIT_01s0010g01870 modulation on grapevine performance under various environmental conditions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery times may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
VIT_01s0010g01870; GSVIVT00035166001; GSVIVT01010256001; VIT_00010256001; Vv01s0010g01870; CASP-like protein 2A1; VvCASPL2A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
VIT_01s0010g01870
Target Protein Sequence
MMGDKGEKECATASSPIELGCGEGDESGNKSSMRTVETLLRLVPVALCTVSLVVMLKNSQ TNDFGSLSYSDLGAFRYLVHANGICAGYSLLSAIFTAMPRPPTMSRAWTFFLLDQVLTYL ILAAGAVSTEVVYLAYKGDEAVTWSDACSSFGGFCQKTTASISITFVTVLCYAVLSLISS YKLFSKYDAPICFNGKGIEIAAFHS
Uniprot No.

Target Background

Database Links

KEGG: vvi:100249479

UniGene: Vvi.1372

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CASP-like protein VIT_01s0010g01870 and how is it classified?

CASP-like protein VIT_01s0010g01870 (officially named CASP-like protein 2A1, NCBI GeneID: 100249479) is a four-transmembrane protein from Vitis vinifera that belongs to the broader family of CASP-like (CASPL) proteins. This protein has a molecular weight of 21,968 Da and shares structural similarities with CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASPs), which are involved in forming membrane scaffolds and directing cell wall modifications .

From an evolutionary perspective, CASPLs are found across all major divisions of land plants and green algae, with VIT_01s0010g01870 representing a specific variant in grapevine. Interestingly, CASPL proteins show homology to the MARVEL protein family found outside the plant kingdom, indicating a deep evolutionary conservation of this protein structure .

What experimental techniques are optimal for purifying recombinant VIT_01s0010g01870?

For optimal purification of recombinant VIT_01s0010g01870, a multi-step approach is recommended:

  • Expression System Selection: The protein can be expressed in E. coli, yeast, baculovirus, or mammalian cell systems. The choice depends on research requirements:

    • E. coli systems offer high yield but may have limitations for post-translational modifications

    • Mammalian and insect cell systems provide better folding for membrane proteins

  • Purification Protocol:

    • Initial extraction using membrane solubilization buffers containing mild detergents

    • Affinity chromatography (if tagged) followed by size exclusion chromatography

    • Ion exchange chromatography for higher purity

  • Quality Control:

    • SDS-PAGE analysis to confirm purity (target ≥85%)

    • Mass spectrometry to verify intact mass (expected 21,968 Da)

    • Western blot using anti-tag or specific antibodies

The purified protein should be stored at -20°C or -80°C for long-term storage, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise structural integrity .

How can domain-specific mutagenesis be used to investigate VIT_01s0010g01870 function?

Domain-specific mutagenesis represents a powerful approach to dissect the functional significance of specific regions within VIT_01s0010g01870. Based on the conservation patterns observed in CASP/CASPL proteins, several targeted approaches can be employed:

Transmembrane Domain Mutagenesis:

  • Target the highly conserved Asp residue in TM3 (equivalent to D134 in AtCASP1), which appears essential for proper protein folding

  • Studies with related proteins show that mutations in this position can completely abolish protein expression or localization

Extracellular Loop Modifications:

  • EL1 (first extracellular loop) shows poor conservation among CASPLs generally but contains a nine-amino acid signature (ESLPFFTQF) in spermatophytes that may have endodermis-specific functions

  • EL2 (second extracellular loop) shows higher conservation and may be involved in protein-protein interactions

Experimental Design Table for Mutagenesis Studies:

DomainTarget ResiduesMutation TypeExpected OutcomeControls
TM3Conserved AspD→H substitutionLoss of protein folding/functionWild-type protein
TM3Conserved basic/acidic residuesConservative substitutionsAltered membrane localizationWild-type protein
EL1Nine-amino acid signatureDeletionImpaired endodermis-specific functionWild-type protein
EL2Conserved residuesAlanine scanningDisrupted protein-protein interactionsWild-type protein

When implementing this approach, researchers should incorporate fluorescent protein tags to monitor localization and use complementation assays in Arabidopsis mutants to assess functional rescue. The data from such studies would clarify which domains are essential for the protein's subcellular localization versus its functional interactions .

What techniques can resolve controversies about membrane domain formation by VIT_01s0010g01870?

Resolving controversies about membrane domain formation by VIT_01s0010g01870 requires multi-faceted approaches that examine both the protein's behavior and its interactions with membrane components:

  • Advanced Imaging Techniques:

    • Super-resolution microscopy (STORM/PALM) to visualize nanoscale membrane domain formation

    • FRET analysis to measure protein-protein interactions within putative domains

    • Fluorescence recovery after photobleaching (FRAP) to assess membrane domain stability and protein turnover

  • Biochemical Approaches:

    • Detergent-resistant membrane fractionation to isolate potential membrane domains

    • Co-immunoprecipitation with domain markers to identify interaction partners

    • Crosslinking mass spectrometry to capture transient interactions

  • Heterologous Expression Systems:

    • Expression in the Arabidopsis endodermis to compare with known CASP behaviors

    • Yeast membrane systems to assess autonomous domain formation capacity

When interpreting results, researchers should specifically address whether VIT_01s0010g01870 forms stable membrane domains similar to those observed with CASPs in the endodermis, where they show extremely low turnover and block the diffusion of membrane proteins like NOD26-LIKE INTRINSIC PROTEIN5;1 and BORON TRANSPORTER1 .

How has the evolutionary history of VIT_01s0010g01870 shaped its functional specialization?

The evolutionary trajectory of VIT_01s0010g01870 provides important insights into its functional specialization in Vitis vinifera. Comparative genomic analyses reveal several key evolutionary aspects:

  • Phylogenetic Position:

    • VIT_01s0010g01870 belongs to the broader CASPL family, which predates the emergence of true CASPs

    • The protein shows homology to MARVEL domain proteins found across eukaryotes, suggesting ancient origins of the four-transmembrane scaffold structure

  • Structural Evolution:

    • The core transmembrane domains show high conservation with both plant CASPLs and non-plant MARVEL proteins

    • Conserved basic (Arg, His, Lys) and acidic (Asp, Glu) amino acids in TM1 and TM3 are shared features between CASPLs and MARVELs, indicating functional importance

  • Functional Diversification:

    • Unlike specialized CASPs that form the Casparian strip in the endodermis, VIT_01s0010g01870 likely has diversified functions in grapevine

    • The absence of the nine-amino acid signature found in spermatophyte CASPs suggests it may not participate in endodermis-specific functions

This evolutionary context suggests that VIT_01s0010g01870 represents a more generalized membrane scaffold protein that might form specialized membrane domains in Vitis vinifera, potentially involved in cell wall modifications distinct from the Casparian strip formation seen in Arabidopsis .

What experimental approaches can determine if VIT_01s0010g01870 functions are conserved across plant species?

To establish whether the functions of VIT_01s0010g01870 are conserved across plant species, several complementary experimental approaches should be employed:

  • Heterologous Expression Studies:

    • Express VIT_01s0010g01870 in model systems like Arabidopsis under control of endogenous CASP promoters

    • Test whether VIT_01s0010g01870 can rescue Arabidopsis casp mutant phenotypes

    • Compare localization patterns with endogenous CASPs using fluorescent fusion proteins

  • Reciprocal Complementation:

    • Express Arabidopsis CASPs in Vitis vinifera systems to assess functional equivalence

    • Analyze whether chimeric proteins (with domains swapped between VIT_01s0010g01870 and AtCASPs) retain functionality

  • Promoter Analysis:

    • Investigate whether the regulatory elements governing VIT_01s0010g01870 expression are conserved with those of CASP genes in other species

    • Test the activity of the VIT_01s0010g01870 promoter in heterologous systems

Previous research with Lotus japonicus CASP homologs demonstrated that a 2-kb genomic fragment upstream of the translational start codon was sufficient to drive endodermis-specific expression in Arabidopsis, suggesting conservation of regulatory elements . Similar approaches could determine whether VIT_01s0010g01870 shares this regulatory conservation or has evolved distinct expression patterns in grapevine.

What are the optimal experimental conditions for analyzing membrane domain formation by VIT_01s0010g01870?

Establishing optimal experimental conditions for analyzing membrane domain formation by VIT_01s0010g01870 requires careful consideration of multiple parameters:

Expression System Selection:

  • Plant cell culture systems (preferably Vitis vinifera-derived) maintain native membrane composition

  • Arabidopsis protoplasts offer a well-characterized alternative with established protocols

  • Heterologous systems should include proper controls for membrane composition differences

Fusion Protein Design Considerations:

  • C-terminal vs. N-terminal tags may differentially affect membrane insertion

  • Linker length and composition critically influence membrane protein topology

  • Spectral variants should be selected to minimize bleed-through in co-localization studies

Imaging Parameters:

  • Live cell imaging vs. fixed samples (trade-offs between dynamics and resolution)

  • Temporal resolution (CASP domains show initial broad membrane distribution followed by focused localization)

  • Photobleaching considerations for long-term imaging

Recommended Protocol for Initial Characterization:

  • Generate both N- and C-terminal fluorescent fusions (mGFP, mCherry)

  • Express in both native tissue (Vitis vinifera) and model system (Arabidopsis)

  • Perform time-course imaging from initial expression (6h) to steady state (48h)

  • Quantify domain formation using fluorescence intensity distribution analysis

  • Compare with known membrane domain markers and assess co-localization

This approach allows researchers to determine whether VIT_01s0010g01870 forms stable membrane domains similar to CASPs, which show extremely low turnover and create membrane diffusion barriers .

How can researchers accurately assess interactions between VIT_01s0010g01870 and cell wall modification enzymes?

Investigating interactions between VIT_01s0010g01870 and cell wall modification enzymes requires multiple complementary approaches:

  • In vitro Interaction Studies:

    • Pull-down assays using purified VIT_01s0010g01870 and candidate enzymes

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters of interactions

  • In vivo Interaction Studies:

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

    • Förster resonance energy transfer (FRET) to measure proximity in membrane

    • Co-immunoprecipitation from native tissues followed by mass spectrometry

  • Functional Impact Assessment:

    • Cell wall composition analysis in VIT_01s0010g01870 overexpression/knockout lines

    • Immunolocalization of wall modifications in relation to protein localization

    • Enzyme activity assays in the presence/absence of VIT_01s0010g01870

Experimental Design Table for Interaction Studies:

TechniqueAdvantagesLimitationsControls Required
BiFCVisualizes in vivo interactionsIrreversible complex formationSplit-YFP fusions with non-interacting proteins
FRETDetects dynamic interactionsRequires careful fluorophore selectionDonor-only, acceptor-only samples
Co-IP/MSIdentifies novel interaction partnersMay detect indirect interactionsIgG controls, reverse IP confirmation
SPRQuantifies binding kineticsRequires purified proteinsReference channel, concentration series

Based on studies with related CASPs, which interact with secreted peroxidases to mediate lignin deposition in Casparian strips, researchers should particularly investigate interactions with lignin biosynthesis enzymes and peroxidases in Vitis vinifera .

How might VIT_01s0010g01870 contribute to grapevine stress responses and what experimental designs can test this?

VIT_01s0010g01870, as a CASP-like protein potentially involved in membrane domain formation and cell wall modification, may play significant roles in grapevine stress responses. Several experimental approaches can test this hypothesis:

  • Expression Analysis Under Stress Conditions:

    • qRT-PCR and RNA-seq to quantify VIT_01s0010g01870 expression under various stressors (drought, salinity, pathogens)

    • Promoter-reporter constructs to visualize tissue-specific expression changes

    • Proteomics to assess post-translational modifications under stress

  • Functional Studies:

    • CRISPR/Cas9-mediated knockouts or RNAi lines with reduced VIT_01s0010g01870 expression

    • Overexpression lines to assess gain-of-function phenotypes

    • Complementation with wild-type vs. mutated versions to identify critical domains

  • Phenotypic Characterization:

    • Cell wall composition analysis using FTIR, immunolabeling, and mass spectrometry

    • Stress tolerance assays measuring physiological parameters (water loss, electrolyte leakage)

    • Histochemical staining to visualize potential barrier functions

The research should focus on whether VIT_01s0010g01870 participates in forming diffusion barriers similar to Casparian strips, which could contribute to stress tolerance by regulating water and solute movement through plant tissues. This would be consistent with the known functions of CASPs in Arabidopsis, where they create membrane scaffolds that direct the deposition of lignin in cell walls, forming critical diffusion barriers .

What technical challenges must be overcome for successful heterologous expression of functional VIT_01s0010g01870?

Heterologous expression of functional VIT_01s0010g01870 presents several technical challenges that must be addressed:

  • Membrane Protein Solubility and Folding:

    • Optimization of detergents for extraction (screen CHAPS, DDM, digitonin)

    • Co-expression with molecular chaperones to improve folding

    • Testing multiple expression temperatures (16°C, 25°C, 30°C)

  • Expression System Selection:

    • E. coli systems: Codon optimization, specialized strains (e.g., C41/C43)

    • Yeast systems: Selection of appropriate promoters for membrane proteins

    • Insect/mammalian systems: Optimization of transfection/infection protocols

  • Functional Verification Approaches:

    • Fluorescence-based localization assays to confirm membrane integration

    • Split-ubiquitin assays to verify protein-protein interactions

    • Liposome reconstitution to assess autonomous domain formation

Optimization Protocol Table for Expression Systems:

Expression SystemKey ParametersAdvantagesDisadvantages
E. coliStrain (BL21, C41/C43), temperature (16-30°C), induction levelHigh yield, low costLimited post-translational modifications
YeastStrain (P. pastoris, S. cerevisiae), induction methodEukaryotic processing, high densityLonger expression time
Insect cellsCell line (Sf9, High Five), viral titerNative-like membrane environmentComplex setup, higher cost
Plant cellsTransient vs. stable expressionMost native environmentLower yields, technically challenging

For initial verification of functionality, researchers should express VIT_01s0010g01870 in Arabidopsis endodermis (where CASPs normally function) and assess whether it can integrate into the CASP membrane domain, as previous studies have shown that most CASPLs can integrate into this domain when ectopically expressed .

What bioinformatic approaches are most effective for predicting VIT_01s0010g01870 interaction networks?

Predicting interaction networks for VIT_01s0010g01870 requires a multi-layered bioinformatic approach:

  • Sequence-Based Methods:

    • Protein-protein interaction prediction based on primary sequence features

    • Motif identification in extracellular and cytoplasmic domains

    • Conservation analysis to identify functionally important residues across species

  • Structure-Based Methods:

    • Homology modeling based on related MARVEL/CASPL structures

    • Molecular docking simulations with candidate interacting proteins

    • Molecular dynamics simulations to assess stability of predicted interactions

  • Network Integration Approaches:

    • Co-expression network analysis using Vitis vinifera transcriptome data

    • Ortholog-based prediction using known CASP interaction networks

    • Gene ontology enrichment analysis of predicted interactors

Workflow for Comprehensive Interaction Prediction:

  • Generate homology model of VIT_01s0010g01870 based on CASP/MARVEL structures

  • Predict transmembrane topology and identify exposed interaction surfaces

  • Perform large-scale docking with candidate cell wall modification enzymes

  • Filter candidates based on co-expression in relevant tissues/conditions

  • Validate top candidates experimentally through techniques outlined in section 4.2

Based on known CASP interactions, particular attention should be paid to potential associations with lignin biosynthesis enzymes, peroxidases, and membrane transporters that might be restricted to specific domains by VIT_01s0010g01870 scaffold formation .

How can contradictory experimental results regarding VIT_01s0010g01870 function be reconciled through methodological refinements?

When faced with contradictory experimental results regarding VIT_01s0010g01870 function, researchers should systematically address methodological variables:

  • Experimental Context Factors:

    • Expression level effects (overexpression artifacts vs. physiological levels)

    • Cell/tissue type differences (heterologous vs. native environments)

    • Developmental timing (protein function may vary across developmental stages)

  • Technical Variables:

    • Tag interference (size, position, and nature of fusion tags)

    • Sample preparation artifacts (fixation, membrane disruption)

    • Detection threshold limitations (sensitivity vs. specificity trade-offs)

  • Standardization Approaches:

    • Establish standard operating procedures for key experiments

    • Implement quantitative controls for expression levels

    • Develop reporter systems that minimize experimental perturbation

Decision Tree for Resolving Contradictory Results:

  • Categorize contradictions (localization, interaction, phenotype)

  • Evaluate methodological differences between studies

  • Design controlled experiments that systematically vary one parameter at a time

  • Implement orthogonal techniques to verify key findings

  • Consider biological context (developmental stage, tissue specificity)

When analyzing VIT_01s0010g01870 function, researchers should remember that CASP activities in forming membrane scaffolds and directing cell wall modifications can be uncoupled, as formation of the CASP domain is independent from lignin deposition. Similarly, interactions between CASPs and peroxidases can occur outside their native domains when ectopically expressed . These aspects may explain apparently contradictory results observed in different experimental setups.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.