Recombinant Vitis vinifera Casparian strip membrane protein VIT_06s0080g00840 (VIT_06s0080g00840)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
VIT_06s0080g00840; GSVIVT00037312001; GSVIVT01036085001; VIT_00036085001; Vv06s0080g00840; Casparian strip membrane protein 2; VvCASP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
VIT_06s0080g00840
Target Protein Sequence
MKSTGEATAINIGETKSASATTVATTKAIQHPKAGLKRGLAIFDFILRLSAIGAALAATT TMGTTDQTLPFFTQFFQFQASYDDLPAFSFFVIANAIASGYLFLSLPFSIVCIVRPHAMG ARLLLVICDTVMVALTIAAAAAAAAIVYLAHNGNSNANWVAICQQFDDFCQSVSGAVVAS FIAAVLFMLMIVLSAFSLRKH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. Casparian strips are a cell wall modification of the root endodermis that creates an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.
Database Links

KEGG: vvi:100256998

UniGene: Vvi.22409

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is VIT_06s0080g00840 and what is its function in Vitis vinifera?

VIT_06s0080g00840, also known as VvCASP2 (Vitis vinifera Casparian Strip Membrane Protein 2), is a membrane protein that plays a crucial role in forming the Casparian strip in grapevine root endodermis. This protein consists of 201 amino acids and functions as a structural component of the hydrophobic barrier that regulates water and nutrient uptake in plant roots . The protein belongs to the CASP family, which are essential for organizing the precise deposition of lignin that creates the Casparian strip, a critical barrier controlling apoplastic transport between soil solution and vascular tissue.

How is recombinant VIT_06s0080g00840 protein typically produced for research purposes?

Recombinant VIT_06s0080g00840 protein is typically produced using Escherichia coli expression systems. The full-length coding sequence (amino acids 1-201) is cloned into an appropriate expression vector with an N-terminal histidine tag to facilitate purification . Following transformation into E. coli, protein expression is induced under optimized conditions (temperature, IPTG concentration, and duration). The protein is then extracted, purified using affinity chromatography (Ni-NTA resin), and often further purified by size exclusion chromatography. The purified protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage and handling conditions for recombinant VIT_06s0080g00840 protein?

To maintain protein integrity, recombinant VIT_06s0080g00840 should be stored as follows:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Recommended additive5-50% glycerol (final concentration)

For optimal handling, the protein should be briefly centrifuged before opening to collect contents at the bottom of the vial. Repeated freeze-thaw cycles should be strictly avoided to prevent protein degradation and loss of activity . Aliquoting the reconstituted protein is strongly recommended to minimize freeze-thaw events.

How can researchers design experiments to study the role of VIT_06s0080g00840 in Casparian strip formation?

Researchers can employ several experimental approaches to investigate VIT_06s0080g00840's role in Casparian strip formation:

  • Gene Expression Analysis: Using quantitative PCR or RNA-sequencing to compare VIT_06s0080g00840 expression levels in different root zones and under various environmental stresses.

  • Protein Localization Studies: Generating transgenic Vitis vinifera lines expressing VIT_06s0080g00840-GFP fusion proteins to visualize its subcellular localization via confocal microscopy.

  • Gene Silencing/Knockout Experiments: Using RNAi or CRISPR-Cas9 technology to reduce or eliminate VIT_06s0080g00840 expression, followed by phenotypic analyses of Casparian strip integrity.

  • Interaction Studies: Performing co-immunoprecipitation or yeast two-hybrid assays to identify protein partners that interact with VIT_06s0080g00840 during Casparian strip formation.

A robust experimental design should include appropriate controls and follow a systematic approach as outlined in design of experiments (DOE) principles to isolate variables that may affect Casparian strip formation . This would include selecting suitable independent variables (e.g., expression levels, environmental conditions) and dependent variables (e.g., Casparian strip integrity, root hydraulic conductivity) while controlling for external factors.

What methods can be used to assess the interaction between VIT_06s0080g00840 and other Casparian strip proteins?

Several complementary methods can be employed to investigate protein-protein interactions:

  • In vitro Binding Assays: Using purified recombinant VIT_06s0080g00840 with potential interaction partners in pull-down assays or surface plasmon resonance (SPR) to determine binding kinetics and affinity.

  • Bimolecular Fluorescence Complementation (BiFC): Split fluorescent proteins fused to VIT_06s0080g00840 and candidate interacting proteins can reveal interactions in planta through reconstitution of fluorescence when proteins are in close proximity.

  • Förster Resonance Energy Transfer (FRET): Measures energy transfer between fluorophore-tagged proteins to detect interactions with spatial resolution in living cells.

  • Co-localization Studies: Immunofluorescence or dual fluorescent protein tagging to determine if VIT_06s0080g00840 and other Casparian strip proteins occupy the same subcellular locations.

  • Cross-linking Mass Spectrometry: Chemical cross-linking followed by mass spectrometry analysis to identify interaction interfaces between VIT_06s0080g00840 and other proteins.

The choice of method should be based on the specific research question, with consideration of potential artifacts and the need for multiple complementary approaches to confirm genuine interactions.

How can researchers effectively reconstitute recombinant VIT_06s0080g00840 for functional studies?

For functional reconstitution of VIT_06s0080g00840, researchers should follow this optimized protocol:

  • Centrifuge the lyophilized protein vial before opening to ensure all material is at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, avoiding buffers that may interfere with downstream applications.

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for stability, particularly if the protein will be stored for extended periods .

  • For membrane protein functional studies, consider reconstitution into liposomes or nanodiscs to provide a native-like lipid environment:

    • Prepare liposomes using plant lipid extracts or defined lipid mixtures

    • Combine protein and liposomes at appropriate ratios (typically 1:50 to 1:200 protein:lipid)

    • Remove detergent via dialysis or adsorption to Bio-Beads

    • Verify reconstitution success through dynamic light scattering or electron microscopy

  • For protein interaction studies, ensure that the His-tag doesn't interfere with function; consider enzymatic tag removal if necessary.

This methodological approach provides a functionally active preparation suitable for various biochemical and biophysical analyses.

How can genetic variation in VIT_06s0080g00840 across different Vitis species inform functional studies?

Studying genetic variation in VIT_06s0080g00840 across Vitis species can provide valuable insights into structure-function relationships and evolutionary adaptations. Researchers should consider:

  • Comparative Genomic Analysis: Align VIT_06s0080g00840 sequences from various Vitis species to identify conserved and variable regions. Conserved domains likely represent functionally critical regions, while variable regions may contribute to species-specific adaptations.

  • Recombination Rate Assessment: Analyze recombination rates across the genomic region containing VIT_06s0080g00840. Research has shown significant variation in recombination rates across different Vitis species, which may influence genetic diversity at this locus .

  • Heterologous Expression: Express variants from different species in model systems to compare functional properties. This can reveal how sequence variations translate to functional differences.

  • Selective Pressure Analysis: Calculate Ka/Ks ratios (non-synonymous to synonymous substitution rates) to determine if VIT_06s0080g00840 is under positive, negative, or neutral selection in different species or cultivars.

  • Association Studies: Correlate sequence variants with phenotypic differences in Casparian strip formation, stress tolerance, or nutrient uptake efficiency across species.

The genetic analysis should account for the complex genetic background of modern Vitis vinifera cultivars, which have emerged through extensive domestication processes over 9,000 years, involving genetic mixture of domesticated and wild grapes .

What are the methodological considerations for studying VIT_06s0080g00840 expression under different environmental stresses?

When investigating VIT_06s0080g00840 expression under environmental stresses, researchers should implement these methodological considerations:

  • Experimental Design Optimization: Apply design of experiments (DOE) principles to efficiently explore multiple stress factors (temperature, drought, salinity, nutrient deficiency) and their interactions . This systematic approach allows for identification of main effects and interaction effects with minimal experimental runs.

  • Time-Course Analysis: Implement sampling at multiple time points to capture dynamic expression changes, as Casparian strip proteins may show rapid or delayed responses to stresses.

  • Tissue-Specific Sampling: Differentiate between different root zones (meristematic, elongation, maturation) as VIT_06s0080g00840 expression may vary spatially along the root axis.

  • Reference Gene Selection: Carefully validate reference genes for qPCR under each stress condition, as common reference genes may be unstable under certain stresses.

  • Multi-Level Analysis: Integrate transcriptomic (RNA-seq), proteomic, and metabolomic approaches to develop a comprehensive understanding of regulatory networks.

  • Statistical Analysis: Employ appropriate statistical methods to account for biological variability and experimental noise. Consider mixed-effect models when dealing with time-series data.

Stress TypeRecommended ControlsKey Parameters to MonitorSampling Schedule
DroughtWell-watered plants, gradual vs. rapid onsetRelative water content, ABA levels, soil moisture0, 6, 12, 24, 48, 72 hours
SalinityOsmotic control (e.g., mannitol)Na+/K+ ratios, osmotic potential0, 3, 6, 12, 24, 48 hours
Nutrient DeficiencyElement-specific controlsTissue elemental content, deficiency symptoms0, 3, 7, 14, 21 days
TemperatureGradual vs. shock treatmentMembrane integrity, ROS levels0, 1, 3, 6, 12, 24 hours

How can researchers address the challenge of protein misfolding when expressing recombinant VIT_06s0080g00840?

Membrane proteins like VIT_06s0080g00840 are notoriously challenging to express in functional form due to misfolding and aggregation. Researchers can implement these advanced strategies:

  • Expression System Optimization:

    • Test multiple E. coli strains specifically designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Consider eukaryotic expression systems (yeast, insect cells) that may provide more suitable membrane environments

    • Optimize induction conditions: lower temperatures (16-20°C), reduced inducer concentration, and extended expression time

  • Fusion Partner Approach:

    • Employ solubility-enhancing fusion partners (MBP, SUMO, Thioredoxin) at the N-terminus

    • Use specific membrane protein fusion partners like Mistic or YidC

    • Ensure appropriate cleavage sites for tag removal that don't interfere with protein function

  • Codon Optimization:

    • Adjust codons to match the expression host's preferences

    • Analyze and modify mRNA secondary structures that may impede translation

    • Balance GC content for improved expression

  • Membrane Mimetics Selection:

    • Screen multiple detergents (DDM, LMNG, GDN) for extraction and purification

    • Test native-like environments including nanodiscs, liposomes, or styrene-maleic acid lipid particles (SMALPs)

    • Consider bicelles or amphipols for structural studies

  • Quality Control Approaches:

    • Implement fluorescence-detection size exclusion chromatography (FSEC) to assess protein homogeneity

    • Use circular dichroism (CD) spectroscopy to confirm secondary structure integrity

    • Employ thermal stability assays to identify stabilizing conditions

By systematically addressing these aspects, researchers can significantly improve the yield and quality of functional recombinant VIT_06s0080g00840 protein.

How does VIT_06s0080g00840 compare to Casparian strip membrane proteins in other plant species?

VIT_06s0080g00840 (VvCASP2) shares structural and functional similarities with Casparian strip membrane proteins from other plant species, but with notable differences that reflect evolutionary adaptations:

  • Sequence Conservation:

    • Core transmembrane domains show high conservation across species (70-85% similarity with Arabidopsis CASP family proteins)

    • N and C-terminal regions display greater divergence, suggesting species-specific regulatory mechanisms

    • The central hydrophobic region implicated in membrane anchoring remains highly conserved

  • Structural Comparisons:

    • VIT_06s0080g00840 contains the characteristic four transmembrane domains found in all CASP proteins

    • The protein length (201 amino acids) is comparable to Arabidopsis CASP proteins (190-210 amino acids)

    • Vitis CASP proteins may contain unique motifs that could relate to grapevine-specific environmental adaptations

  • Functional Differences:

    • Expression patterns suggest VIT_06s0080g00840 may have more specialized roles in water stress response compared to some model plant CASPs

    • The protein may contribute to the distinctive drought tolerance observed in some Vitis species

    • Interaction partners likely differ from those in Arabidopsis or other model plants

  • Evolutionary Context:

    • Phylogenetic analysis places VIT_06s0080g00840 in a clade with other woody perennial CASP proteins

    • The 9,000-year domestication history of Vitis vinifera has likely shaped the function of this protein

    • Genetic recombination studies suggest this gene may be located in a region with distinct recombination rates compared to other Vitis species

This comparative understanding provides a framework for translating findings between model systems and commercially important crops like grapevine.

What methodologies can be used to study the role of VIT_06s0080g00840 in drought and salt stress responses?

Investigating VIT_06s0080g00840's role in abiotic stress responses requires a multi-faceted methodological approach:

  • Transcriptional Regulation Studies:

    • Perform promoter analysis to identify stress-responsive elements

    • Use chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the VIT_06s0080g00840 promoter

    • Develop reporter gene constructs (e.g., promoter:GUS) to visualize spatial and temporal expression patterns under stress

  • Protein Function Analysis:

    • Measure Casparian strip integrity using fluorescent tracer dyes (e.g., propidium iodide) in wild-type vs. VIT_06s0080g00840-modified plants

    • Quantify root hydraulic conductivity using pressure chamber techniques

    • Assess ion content in roots and shoots to determine if VIT_06s0080g00840 alterations affect ion homeostasis

  • Advanced Imaging Techniques:

    • Implement Raman microspectroscopy to analyze chemical composition of Casparian strips in situ

    • Use transmission electron microscopy (TEM) to examine ultrastructural changes in the Casparian strip under stress

    • Apply fluorescence recovery after photobleaching (FRAP) to measure protein dynamics within the membrane

  • Field-Based Phenotyping:

    • Deploy modified plants with altered VIT_06s0080g00840 expression in controlled field trials

    • Utilize remote sensing (thermal imaging, hyperspectral cameras) to assess water status

    • Implement root phenotyping platforms to examine architectural adaptations to stress

  • Metabolic Impact Assessment:

    • Measure ABA content and signaling components as indicators of stress response

    • Quantify stress metabolites (proline, sugars, polyamines) in relation to VIT_06s0080g00840 expression

    • Perform untargeted metabolomics to identify novel metabolic signatures associated with VIT_06s0080g00840 function

This integrated methodological toolkit enables comprehensive characterization of VIT_06s0080g00840's role in stress adaptation.

How can researchers design experiments to investigate potential genetic recombination hotspots near the VIT_06s0080g00840 locus?

To investigate recombination patterns near the VIT_06s0080g00840 locus, researchers should consider these methodological approaches:

  • Population Selection and Crossing Design:

    • Develop multiple mapping populations using diverse Vitis germplasm:

      • Pure V. vinifera crosses (e.g., Riesling × Cabernet Sauvignon)

      • Interspecific crosses (e.g., V. riparia × V. rupestris)

      • Backcross populations with varying genetic backgrounds

    • Ensure sufficient population size (minimum 100-150 individuals, ideally 200+) for statistical power

  • Marker Development and Genotyping Strategy:

    • Design dense marker coverage around VIT_06s0080g00840 (one marker every 5-10 kb)

    • Utilize simple sequence repeat (SSR) and single nucleotide polymorphism (SNP) markers

    • Implement next-generation sequencing approaches for high-resolution genotyping

  • Linkage Analysis and Recombination Rate Calculation:

    • Construct genetic linkage maps using appropriate software (JoinMap, R/qtl)

    • Calculate recombination frequencies and genetic distances (cM)

    • Identify regions with deviant recombination rates compared to genome-wide averages

  • Physical-to-Genetic Distance Comparison:

    • Compare physical distances (bp) with genetic distances (cM) to identify recombination hotspots

    • Create recombination rate (cM/Mb) plots across the chromosome

    • Test for significant heterogeneity in recombination rates between populations and species

  • Sequence Feature Analysis:

    • Analyze DNA sequence motifs associated with recombination hotspots

    • Assess chromatin structure and epigenetic modifications in the region

    • Investigate the presence of transposable elements that may influence recombination

The identification of recombination patterns is critical for genetic improvement strategies in grapevine, particularly for introgressing beneficial traits from wild Vitis species .

What are the current limitations in studying VIT_06s0080g00840 function, and how might they be overcome?

Current research on VIT_06s0080g00840 faces several methodological and technical challenges:

  • Transformation Efficiency Limitations:

    • Challenge: Vitis species are notoriously recalcitrant to genetic transformation, with low efficiency and long regeneration times.

    • Solution: Implement improved transformation protocols using optimized Agrobacterium strains, vacuum infiltration methods, and tissue-specific promoters. Alternative approaches include virus-induced gene silencing (VIGS) or protoplast transformation for transient studies.

  • Functional Redundancy:

    • Challenge: Multiple CASP family proteins may have overlapping functions, masking phenotypes in single gene studies.

    • Solution: Employ CRISPR-Cas9 multiplex editing to target multiple family members simultaneously. Alternatively, use dominant negative approaches that may disrupt function of multiple related proteins.

  • Developmental Stage Specificity:

    • Challenge: VIT_06s0080g00840 may function at specific developmental stages, complicating phenotypic analysis.

    • Solution: Implement inducible expression systems (e.g., estrogen-inducible or dexamethasone-inducible) to control gene expression temporally. Use single-cell RNA sequencing to capture developmental transitions.

  • Protein Complex Formation:

    • Challenge: VIT_06s0080g00840 likely functions within multi-protein complexes that are difficult to study in isolation.

    • Solution: Apply proximity labeling techniques (BioID, TurboID) to identify interaction partners in vivo. Use cryo-electron microscopy to resolve structures of intact complexes.

  • Field-to-Lab Translation:

    • Challenge: Laboratory findings may not translate to field conditions due to complex environmental interactions.

    • Solution: Establish controlled environment facilities that better mimic field conditions. Validate findings using field trials in multiple environments and over multiple growing seasons.

These strategies can accelerate progress in understanding the fundamental biology of VIT_06s0080g00840 and its applications in grapevine improvement.

How can advanced experimental design approaches improve research on VIT_06s0080g00840 function in grapevine development?

Advanced experimental design can significantly enhance research quality and efficiency:

  • Response Surface Methodology (RSM):

    • Implement central composite or Box-Behnken designs to optimize multiple experimental parameters simultaneously (e.g., temperature, water availability, and nutrient levels)

    • This approach allows researchers to model complex interactions and identify optimal conditions for VIT_06s0080g00840 expression or function

  • Split-Plot Designs for Field Experiments:

    • Utilize hierarchical experimental structures where whole-plot factors (e.g., irrigation regimes) and sub-plot factors (e.g., genotypes) are analyzed appropriately

    • This approach accounts for spatial heterogeneity in field conditions and improves statistical power

  • Sequential Experimentation:

    • Implement adaptive designs that allow modification of experimental protocols based on interim results

    • This approach is particularly valuable for optimizing recombinant protein expression conditions or testing multiple genetic constructs

  • Latin Square and Incomplete Block Designs:

    • Control for environmental gradients in greenhouse or field settings

    • Reduce experimental error while maintaining statistical power with fewer experimental units

  • Bayesian Experimental Design:

    • Incorporate prior knowledge about VIT_06s0080g00840 function into experimental planning

    • Update experimental parameters based on accumulated evidence to maximize information gain

  • Multi-Environment Testing:

    • Test VIT_06s0080g00840 function across diverse environments to assess genotype-by-environment interactions

    • Implement stability analysis to identify consistent effects across conditions

Properly designed experiments following these principles will maximize the validity, reliability, and replicability of findings while optimizing resource use .

What emerging technologies could revolutionize our understanding of VIT_06s0080g00840 and other Casparian strip proteins?

Several cutting-edge technologies are poised to transform research on Casparian strip proteins:

  • Single-Cell and Spatial Transcriptomics:

    • Map VIT_06s0080g00840 expression with unprecedented cellular resolution

    • Correlate expression patterns with cell-specific developmental trajectories in root tissues

    • Combine with spatial proteomics to create multi-omics cellular atlases

  • CRISPR Base and Prime Editing:

    • Introduce precise nucleotide changes without double-strand breaks

    • Create allelic series to study structure-function relationships

    • Modify regulatory elements to fine-tune expression patterns

  • Live-Cell Super-Resolution Microscopy:

    • Visualize Casparian strip formation with nanometer resolution

    • Track protein dynamics and interactions in living root cells

    • Combine with genetically encoded biosensors to correlate protein function with physiological parameters

  • Cryo-Electron Tomography:

    • Resolve 3D structures of Casparian strip proteins in their native cellular context

    • Visualize molecular organization of the Casparian strip at near-atomic resolution

    • Identify structural changes under different environmental conditions

  • Organ-on-a-Chip Technology:

    • Develop root-on-a-chip systems to study Casparian strip formation under precisely controlled conditions

    • Integrate microfluidics with live imaging to manipulate and monitor the root microenvironment

    • Test genetic variants in standardized systems for direct comparison

  • Artificial Intelligence and Machine Learning:

    • Predict protein-protein interactions and functional domains

    • Analyze complex phenotypic data to identify subtle effects of genetic manipulation

    • Design optimal experiments through in silico modeling and simulation

These technologies, particularly when used in combination, have the potential to resolve long-standing questions about Casparian strip formation and function in plant development and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.