Recombinant Vitis vinifera Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
cemA
Target Protein Sequence
MTKKKAFTPLLYLASIVFLPWWISLSLNKSLESWVTNWWNTRQSETFLNDIQEKSILEKF IELEELFLLDEMIKECPETHLQKLRMGIHKETIQLIKMYNEDPIHTILHFSTNIICFVIL SGYSILGNEELLILNSWIQQFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: vvi:4025049

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the Vitis vinifera chloroplast envelope membrane protein (cemA) and what is its function?

The chloroplast envelope membrane protein (cemA) from Vitis vinifera (grape) is a membrane-bound protein coded by the chloroplast genome. It consists of 229 amino acids and plays an essential role in chloroplast membrane function. The protein is characterized by its hydrophobic domains that facilitate membrane integration. The amino acid sequence includes multiple transmembrane regions with the sequence beginning with MTKKKAFTPLLYLASIVFLPWWISLSLNKS and continuing through functional domains that contribute to chloroplast envelope integrity .

The protein functions primarily in maintaining chloroplast membrane stability and may participate in ion transport across the chloroplast envelope. Though specific functions remain under active investigation, comparative genomic analyses suggest conservation of this protein across plant species, indicating its fundamental importance in chloroplast biology.

What expression systems are most effective for producing recombinant Vitis vinifera cemA protein?

Several expression systems have demonstrated efficacy for producing recombinant Vitis vinifera proteins, with the selection dependent on research objectives:

  • Pichia pastoris expression system: This system has been successfully employed for expressing Vitis vinifera proteins as demonstrated in studies using the GS115 strain with the pPICZαA vector. The methanol-inducible promoter enables controlled expression, with optimal induction achieved at 0.75% methanol concentration maintained through periodic supplementation every 24 hours .

  • Saccharomyces cerevisiae expression system: Particularly useful for functional studies, S. cerevisiae has been effectively utilized to express recombinant proteins from Vitis vinifera, with several industrial strains showing robust protein production capabilities .

  • Bacterial expression systems: While less common for membrane proteins, optimized E. coli systems with appropriate fusion tags can yield functional protein for antibody production and structural studies.

The selection of expression system should be guided by the intended application, with yeast-based systems generally providing better folding environments for plant membrane proteins compared to bacterial systems.

What are the optimal storage conditions for maintaining the stability of recombinant cemA protein?

To maintain structural and functional integrity of recombinant Vitis vinifera cemA protein, specific storage conditions must be adhered to:

  • Short-term storage: Working aliquots can be maintained at 4°C for up to one week with minimal degradation .

  • Long-term storage: For extended preservation, the protein should be stored at -20°C, with critical samples preferably maintained at -80°C to minimize freeze-thaw degradation .

  • Buffer composition: The optimal storage buffer includes a Tris-based formulation with 50% glycerol, specifically optimized for the cemA protein's stability requirements .

  • Freeze-thaw cycles: Repeated freezing and thawing should be strictly avoided as this significantly compromises protein integrity. Working aliquots should be prepared during initial processing to limit freeze-thaw events .

  • Protein concentration: Higher protein concentrations (>50 μg/ml) typically demonstrate improved stability during storage compared to dilute preparations.

What are the most effective protocols for purifying recombinant cemA protein while maintaining its native conformation?

Purification of recombinant cemA protein presents significant challenges due to its hydrophobic nature and multiple membrane-spanning domains. The following methodological approach has demonstrated superior outcomes:

  • Initial extraction: For cemA expressed in Pichia pastoris, collection of the supernatant after centrifugation at 3500g for 5 minutes provides an effective crude enzyme fluid .

  • Affinity chromatography: Utilizing the tag incorporated during expression (commonly His-tag or other fusion tags determined during production) enables selective binding and enrichment .

  • Detergent selection: For maintaining native conformation, mild non-ionic detergents (0.1-0.5% n-dodecyl β-D-maltoside) in purification buffers help solubilize the protein while preserving structural integrity.

  • Size exclusion chromatography: As a final polishing step, this technique separates protein aggregates and provides a more homogeneous preparation in a buffer mimicking the chloroplast envelope environment.

  • Verification of conformation: Circular dichroism spectroscopy and limited proteolysis assays can confirm retention of secondary structure elements critical for functional studies.

The purification strategy should be tailored based on downstream applications, with structural studies requiring higher purity standards compared to functional enzymatic assays.

How can CRISPR/Cas9 technology be applied to study cemA function in Vitis vinifera?

CRISPR/Cas9 technology offers powerful approaches for investigating cemA function through targeted gene editing in Vitis vinifera. The following methodology has shown particular promise for grapevine gene editing:

  • Vector selection: BeYDV (Bean yellow dwarf virus)-derived replicon vectors have demonstrated superior performance for expressing CRISPR/Cas9 components in grapevine tissues. The pGMV-U universal vector allows assembly of all necessary CRISPR/Cas9 components with capacity for up to four independent guide RNA (gRNA) expression cassettes .

  • Guide RNA design: Guide RNAs targeting cemA should be designed using specialized tools like the "Grapevine CRISPR Search Tool" with parameters including 40-70% GC content and preferential inclusion of cytosine in the variable nucleotide of the PAM sequence .

  • Delivery method: Agrobacterium-mediated gene transfer to somatic embryos of 'Thompson Seedless' cultivar has proven effective, with marker visualization possible for up to 33 days post-infiltration .

  • Paired gRNA approach: Employing paired gRNAs can induce large deletions within the cemA gene, facilitating more complete functional knockout compared to single-site editing .

  • Verification of edits: PCR-based genotyping followed by sequencing confirmation is essential for validating the intended genetic modifications.

The application of this technology allows for precise investigation of cemA function through phenotypic analysis of knockout or modified plants, revealing its role in chloroplast development, photosynthetic efficiency, and stress responses.

What analytical techniques provide the most comprehensive characterization of cemA protein structure and interactions?

A multi-technique approach yields the most complete characterization of cemA protein structure and interactions:

Analytical TechniqueApplication to cemAResolution/Information
X-ray CrystallographyTertiary structure determinationAtomic resolution (1.5-3Å)
Cryo-Electron MicroscopyMembrane-embedded structureNear-atomic resolution (3-5Å)
Circular DichroismSecondary structure elementsLow resolution, % α-helix/β-sheet
Mass SpectrometryPost-translational modificationsPrecise mass determination
Surface Plasmon ResonanceProtein-protein interaction kineticsReal-time association/dissociation
Hydrogen-Deuterium ExchangeConformational dynamicsRegion-specific solvent accessibility
Fluorescence Resonance Energy TransferIn vivo protein interactionsDynamic interaction assessment

For membrane proteins like cemA, techniques that accommodate the hydrophobic nature of the protein, such as detergent micelles or nanodiscs, are particularly valuable for maintaining native-like conformations during analysis. Additionally, computational approaches including molecular dynamics simulations can complement experimental data by providing insights into dynamic behaviors impossible to capture through static structural methods.

How does cemA protein contribute to chloroplast function and plant stress responses?

The chloroplast envelope membrane protein (cemA) plays multifaceted roles in chloroplast function and stress response mechanisms:

  • Membrane integrity: As a structural component of the chloroplast envelope, cemA contributes to maintaining the physical barrier that enables selective transport and compartmentalization essential for photosynthetic function.

  • Stress signaling: Evidence suggests cemA may participate in redox signaling pathways similar to those described for other chloroplast membrane proteins involved in biotic and abiotic stress responses. This function potentially relates to mechanisms similar to those observed for AIR12 in Arabidopsis, which regulates apoplast redox state during pathogen interactions .

  • Ion homeostasis: Structural analysis indicates cemA may function in ion transport across the chloroplast envelope, particularly during environmental stress conditions when ionic balance is critical for maintaining photosynthetic efficiency.

  • Integration with cellular defense: The protein potentially interacts with pathways similar to those regulated by DEL1 in Arabidopsis, affecting salicylic acid accumulation and defense responses, though direct evidence in Vitis vinifera requires further investigation .

Understanding these functions provides critical context for developing stress-tolerant grapevine varieties through biotechnological approaches and targeted breeding programs.

What experimental approaches can differentiate between direct and indirect effects of cemA mutations on plant phenotype?

Distinguishing direct from indirect effects of cemA mutations requires sophisticated experimental designs:

  • Complementation studies: Reintroducing wild-type or modified cemA variants into knockout lines can confirm phenotype reversal and establish direct causation. This approach should include controls with catalytically inactive variants to distinguish structural from enzymatic functions.

  • Temporal expression control: Utilizing inducible promoter systems (like methanol-inducible systems in yeast or dexamethasone-inducible systems in planta) allows observation of immediate versus delayed effects following cemA expression, helping separate primary from secondary consequences .

  • Protein-protein interaction mapping: Techniques such as proximity labeling coupled with mass spectrometry can identify the immediate interactome of cemA, revealing direct molecular partners versus downstream pathway components.

  • Metabolomic profiling: Comparative metabolite analysis of wild-type, knockout, and complemented lines at multiple time points post-induction can reveal metabolic pathways directly versus secondarily affected by cemA function.

  • Transcriptomic time-course analysis: RNA-seq at defined intervals following cemA modification can distinguish immediate transcriptional responses (potential direct effects) from later adaptive responses (indirect effects).

These approaches collectively provide a framework for establishing the causal relationship between cemA function and observed phenotypic outcomes in transformed plant lines.

How can recombinant cemA protein be employed in functional enzyme assays?

Functional enzyme assays with recombinant cemA require carefully designed experimental conditions that account for its membrane-associated nature:

  • Reconstitution systems: Incorporation into liposomes or nanodiscs provides a membrane-like environment necessary for proper protein folding and function. Lipid composition should mimic the chloroplast envelope, typically including monogalactosyldiacylglycerol (MGDG) and digalactosyldiacylglycerol (DGDG).

  • Activity measurements: Depending on the hypothesized function, assays may include:

    • Ion transport studies using fluorescent indicators or ion-selective electrodes

    • Redox activity measurements using appropriate electron donors and acceptors

    • Enzyme-coupled spectrophotometric assays for metabolic functions

  • Control experiments: Essential controls include:

    • Heat-denatured protein as negative control

    • Known functional homologs from model species as positive controls

    • Concentration-dependent activity measurements to establish enzyme kinetics

  • Environmental parameters: Activity assessment should occur across a range of pH (6.0-8.0), temperature (10-40°C), and ionic strength conditions to determine optimal functioning parameters and physiological relevance.

  • Inhibitor studies: Selective inhibitors can help define the catalytic mechanism and active site characteristics, with subsequent structure-function analyses through site-directed mutagenesis of key residues.

These methodologies provide a comprehensive framework for characterizing the enzymatic properties of cemA and elucidating its functional role in chloroplast biology.

How does Vitis vinifera cemA protein compare structurally and functionally to homologs in other plant species?

Comparative analysis reveals important evolutionary relationships and functional conservation of cemA across plant species:

  • Sequence conservation: The cemA protein shows moderate sequence conservation across land plants, with higher homology in core functional domains and transmembrane regions. Key motifs including the N-terminal sequence (MTKKKAFTPLLYLASIVFLPWWISLSLNKS) show higher conservation than intervening regions .

  • Structural predictions: Hydropathy plots indicate similar topological organization across species, with consistent prediction of membrane-spanning regions despite sequence divergence in connecting loops, suggesting functional constraints on structural elements rather than primary sequence.

  • Functional complementation: Cross-species functionality studies demonstrate that cemA homologs can partially rescue phenotypes in heterologous systems, indicating conservation of core functions despite sequence divergence.

  • Evolutionary rate analysis: Compared to other chloroplast-encoded proteins, cemA shows intermediate evolutionary rates, suggesting balanced selection pressures between conservation of function and adaptation to species-specific requirements.

  • Co-evolution patterns: Statistical coupling analysis reveals co-evolving amino acid networks that likely represent functional interaction surfaces conserved across diverse plant lineages.

These comparative insights provide context for understanding cemA function in Vitis vinifera and can guide experimental approaches by highlighting conserved features most likely to be functionally significant.

What are the key considerations when interpreting contradictory experimental data regarding cemA function?

Resolving contradictory findings about cemA function requires systematic analysis and consideration of multiple factors:

  • Experimental system variation: Results obtained in heterologous expression systems like Pichia pastoris may differ from those in native plant contexts due to differences in post-translational modifications, membrane composition, and protein folding machinery .

  • Technical limitations in membrane protein analysis: Membrane proteins like cemA present unique challenges in purification and functional characterization, potentially leading to artifacts or partial activity that can yield contradictory results.

  • Genetic background effects: The phenotypic consequences of cemA modifications may vary depending on genetic background, with compensatory mechanisms present in some cultivars but not others.

  • Environmental context dependence: cemA function may manifest differently under various growth conditions, particularly stress conditions, explaining apparently contradictory results from experiments conducted under different environmental parameters.

  • Methodological differences in CRISPR/Cas9 applications: Variations in gene editing efficiency, off-target effects, and the specific nature of genetic modifications can influence experimental outcomes when studying cemA function through knockout approaches .

When faced with contradictory data, researchers should systematically evaluate these factors and design experiments that directly test alternative hypotheses with appropriate controls for each potential confounding variable.

How can computational approaches enhance understanding of cemA protein dynamics and interactions?

Computational methods offer powerful approaches to investigate aspects of cemA biology challenging to address experimentally:

  • Molecular dynamics simulations: All-atom simulations in membrane environments can reveal conformational dynamics of cemA, identifying potential ion channels, substrate binding sites, or conformational changes triggered by interactions with other molecules.

  • Homology modeling: Despite limited structural data for cemA specifically, models based on distantly related proteins with solved structures can provide initial structural hypotheses for experimental testing.

  • Protein-protein interaction prediction: Algorithms analyzing surface complementarity, electrostatic potential, and conservation patterns can predict potential interaction partners for cemA, guiding experimental validation.

  • Molecular docking: In silico screening of metabolite libraries against cemA structural models can identify potential substrates or regulatory molecules for subsequent experimental verification.

  • Network analysis: Integration of cemA into predicted protein-protein interaction networks and metabolic pathways can reveal its potential systemic role in chloroplast function and stress responses.

  • Machine learning approaches: Trained on existing chloroplast protein datasets, these methods can predict cemA subcellular localization patterns, post-translational modifications, and functional associations with greater accuracy than traditional sequence-based methods.

These computational approaches provide cost-effective means to generate testable hypotheses about cemA function and prioritize experimental directions most likely to yield significant insights.

What emerging technologies will advance our understanding of cemA protein in Vitis vinifera?

Several cutting-edge technologies show particular promise for cemA research:

  • Cryo-electron tomography: This technique can visualize cemA in its native membrane environment at near-atomic resolution, revealing structural arrangements impossible to capture through traditional crystallography approaches.

  • Single-molecule FRET: By tracking dynamic conformational changes in real-time, this approach can elucidate the functional cycle of cemA during transport or catalytic processes.

  • Advanced CRISPR applications: Base editing and prime editing technologies offer more precise genetic modifications than traditional CRISPR/Cas9, enabling subtle alterations to cemA sequence without complete gene disruption .

  • Spatial transcriptomics and proteomics: These approaches can map the co-expression networks and protein-protein interactions of cemA with subcellular resolution, providing contextual understanding of its function.

  • Nanobody-based probes: Camelid antibody fragments can be developed against specific cemA conformational states, enabling tracking of structural changes in vivo with minimal disruption.

  • Optogenetic approaches: Light-controlled protein variants could allow temporal and spatial control of cemA function, facilitating precise dissection of its role in chloroplast biology.

These technologies collectively promise to overcome current limitations in studying membrane proteins like cemA and provide unprecedented insights into its functional role in grapevine biology.

How can systems biology approaches integrate cemA research into broader understanding of chloroplast function?

Systems biology provides frameworks for contextualizing cemA within comprehensive models of chloroplast biology:

  • Multi-omics integration: Combining transcriptomic, proteomic, metabolomic, and phenomic data from cemA-modified plants enables identification of system-wide effects and regulatory networks involving this protein.

  • Flux balance analysis: Mathematical modeling of metabolic networks incorporating cemA function can predict changes in photosynthetic efficiency, redox balance, and metabolite production under various environmental conditions.

  • Gene regulatory network reconstruction: Temporal analysis of transcriptional changes following cemA perturbation can reveal regulatory cascades and feedback mechanisms governing chloroplast responses to environmental stimuli.

  • Comparative systems analysis: Cross-species comparison of chloroplast systems incorporating cemA homologs can identify conserved and divergent aspects of its function across evolutionary lineages.

  • Machine learning classification: Pattern recognition in large datasets can identify subtle phenotypic signatures associated with cemA variants, potentially revealing functions not apparent through targeted hypothesis testing.

These approaches shift research focus from isolated protein function to understanding cemA's role in maintaining chloroplast homeostasis and responding to environmental changes, providing a more comprehensive perspective on its biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.