Recombinant Vitis vinifera Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: vvi:4025130

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the PetD subunit play?

The cytochrome b6-f complex functions as a crucial electron transfer intermediary between photosystems II and I in the photosynthetic electron transport chain. PetD (subunit 4) forms a mildly protease-resistant subcomplex with cytochrome b6 that serves as an essential template for the assembly of other components, including Cyt f and PetG, ultimately producing a functional complex . This initial PetD-Cyt b6 interaction is foundational, as PetD becomes notably unstable in the absence of Cyt b6 . Furthermore, both Cyt b6 and PetD are prerequisites for the synthesis of Cyt f, highlighting their critical role in the complex assembly pathway . The PetD protein has a molecular weight of approximately 17.4 kDa and its proper assembly is essential for maintaining photosynthetic efficiency.

How does PetD contribute to the stability and assembly of the cytochrome b6-f complex?

PetD contributes significantly to both the stability and assembly process of the cytochrome b6-f complex through multiple mechanisms. First, it forms a stable subcomplex with Cyt b6 that functions as the core foundation upon which the complete complex is built . This PetD-Cyt b6 interaction creates a protease-resistant template that facilitates the recruitment and proper positioning of additional components such as Cyt f and PetG . The crucial nature of this interaction is demonstrated by observations that when either Cyt b6 or PetD is inactivated, the synthesis of Cyt f is dramatically reduced .

In assembly studies using Blue Native-PAGE (BN-PAGE), researchers have observed that alterations in PetD levels affect the ratio between monomeric and dimeric forms of the complex . Additionally, pulse-chase labeling experiments reveal that newly synthesized PetD that fails to incorporate into the complex exhibits remarkably short half-lives, whereas properly assembled subunits demonstrate significant stability . This suggests that PetD plays a dual role in both initiating complex assembly and maintaining the structural integrity of the mature complex.

What are the structural characteristics of PetD in photosynthetic organisms?

PetD is a membrane-integrated subunit of the cytochrome b6-f complex with conserved structural elements across photosynthetic organisms. The protein contains transmembrane domains that anchor it within the thylakoid membrane, positioning it optimally for interaction with other complex components. Based on antibody development information, PetD contains specific epitope regions that are sufficiently conserved to allow cross-reactivity between diverse photosynthetic organisms including Arabidopsis thaliana, Synechocystis sp., Synechococcus sp., Cyanobacterium aponinum, and Chlorogloeopsis sp. .

The functional importance of PetD is underscored by the presence of conserved domains that facilitate specific protein-protein interactions, particularly with Cyt b6. These interaction sites are critical for the initial assembly steps of the complex . Additionally, the proper folding and membrane insertion of PetD are essential for its function, as misfolded proteins would likely be rapidly degraded, as suggested by the short half-lives observed for unassembled PetD in mutant studies .

What expression systems are most appropriate for producing recombinant Vitis vinifera PetD?

Selecting an appropriate expression system for recombinant Vitis vinifera PetD requires careful consideration of the protein's membrane-bound nature and complex assembly requirements. Based on successful approaches with other Vitis vinifera proteins, the Pichia pastoris yeast expression system offers significant advantages . This eukaryotic system provides a more suitable environment for proper folding and post-translational modifications compared to bacterial systems. When implementing this approach, expression can be induced with methanol maintained at a 0.75% final concentration, with samples collected every 12-24 hours to monitor protein accumulation .

For membrane proteins like PetD, specialized expression vectors that facilitate proper folding and membrane insertion are essential. Expression constructs should include appropriate targeting sequences to direct the protein to the correct cellular compartment. Additionally, co-expression with interaction partners like Cyt b6 may enhance stability and functional yield, given their documented interaction and co-dependency .

Alternative systems worth considering include:

  • Specialized bacterial strains engineered for membrane protein expression (C41/C43)

  • Plant-based expression systems that more closely mimic PetD's native environment

  • Cell-free expression systems with supplied lipid environments for direct incorporation

Each system requires optimization of parameters including temperature, induction timing, and media composition to maximize yield of properly folded, functional protein.

What methods are most effective for purifying recombinant PetD while maintaining its structural integrity?

Purifying membrane proteins like PetD requires specialized approaches to maintain structural integrity throughout the process. A comprehensive purification strategy would include:

  • Membrane fraction isolation: Following expression, cells should be disrupted (potentially using methods like beadbeating as described for cyanobacterial proteins ) and membrane fractions isolated via differential centrifugation.

  • Detergent solubilization: Carefully selected mild detergents should be used to extract PetD from membranes while preserving native structure. Based on protocols used for similar photosynthetic proteins, detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin would be appropriate starting points.

  • Affinity chromatography: If the recombinant PetD includes an affinity tag, this provides an efficient initial purification step. For example, a His-tagged construct would enable nickel affinity chromatography under conditions optimized to maintain protein stability.

  • Size exclusion chromatography: This technique allows separation of properly folded protein from aggregates and provides information about the oligomeric state of the protein.

Throughout the purification process, maintaining an appropriate buffer environment is critical. Based on extraction protocols mentioned in the search results, buffer components such as Tris-HCl (pH 7.5-7.6), glycerol (10%), and protease inhibitors are essential for preserving protein integrity . Additionally, considering PetD's native environment, the inclusion of specific lipids may help maintain structural stability during purification.

How can researchers verify the proper folding and functionality of recombinant PetD?

Verifying the proper folding and functionality of recombinant PetD requires multiple complementary approaches:

  • Structural analysis: Techniques like circular dichroism spectroscopy can assess whether the recombinant protein has the expected secondary structure content, providing initial confirmation of proper folding.

  • Complex formation assay: Since PetD naturally forms a subcomplex with Cyt b6 , assessing the ability of recombinant PetD to form this complex provides strong evidence of proper folding. This can be evaluated using techniques like BN-PAGE, which has been successfully used to visualize cytochrome b6-f complex assembly states including monomers, dimers, and intermediates .

  • Protease resistance testing: The search results indicate that the PetD-Cyt b6 subcomplex shows mild protease resistance . Therefore, comparing the protease sensitivity of recombinant PetD (especially in the presence of Cyt b6) with that of the native protein can indicate proper folding.

  • Antibody recognition: Using validated antibodies like those described in search result , researchers can confirm that recombinant PetD presents the correct epitopes, which would be disrupted in misfolded proteins.

  • Functional reconstitution: The ultimate test of functionality would involve reconstituting recombinant PetD with other components of the cytochrome b6-f complex and measuring electron transport activity.

When analyzing recombinant PetD via western blotting, techniques described in the search results include using gradient SDS-PAGE (8-16%) with MOPS buffer, wet transfer to nitrocellulose membranes, and detection with specific antibodies at appropriate dilutions (e.g., 1:1000 for primary antibodies) .

What techniques are most effective for studying PetD-protein interactions in the cytochrome b6-f complex?

Investigating PetD-protein interactions within the cytochrome b6-f complex requires sophisticated approaches that preserve native interactions while providing detailed molecular information:

  • Blue Native-PAGE (BN-PAGE): This technique has been successfully employed to study the assembly states of the cytochrome b6-f complex, revealing the distribution between monomers, dimers, and assembly intermediates . For PetD-specific analysis, immunodetection following BN-PAGE using anti-PetD antibodies can specifically track this subunit through various assembly states.

  • Co-immunoprecipitation with pulse-chase labeling: This powerful combination, demonstrated in the search results, allows analysis of newly synthesized proteins and their incorporation into complexes . By pulse-labeling with radioactive amino acids for defined periods (10-30 minutes) followed by immunoprecipitation with specific antibodies, researchers can track the dynamic assembly of PetD with its interaction partners.

  • Crosslinking combined with mass spectrometry: This approach can identify specific interaction interfaces between PetD and other subunits of the complex, providing molecular-level detail about protein-protein contacts.

  • Ribosome profiling: The search results mention analyzing ribosomal loading of specific RNAs to visualize translation initiation efficiency . This approach can reveal how the synthesis of PetD is coordinated with other components of the complex.

  • Stability assessments: As demonstrated in the search results, treating samples with translation inhibitors like lincomycin followed by time-course analysis can reveal the stability of PetD within assembled complexes versus its stability as a free subunit .

These techniques can be complemented by structural approaches such as cryo-electron microscopy to obtain high-resolution information about PetD's position and interactions within the fully assembled complex.

How do mutations in petD affect cytochrome b6-f complex assembly and photosynthetic efficiency?

Analysis of mutants affecting the cytochrome b6-f complex, such as the dac mutant described in search result , reveals several key consequences that would likely apply to petD mutations:

  • Altered complex assembly: BN-PAGE analysis of mutants shows changes in the distribution of complex forms, with reduced levels of both dimers and monomers and altered ratios between these forms . PetD mutations would likely disrupt these assembly patterns, potentially increasing the proportion of assembly intermediates relative to functional complexes.

  • Reduced accumulation of complex subunits: The search results demonstrate that mutations affecting the complex lead to dramatically reduced levels of certain subunits, with longer exposure times required to detect bands in BN-PAGE . PetD mutations would likely affect the accumulation of multiple subunits due to the interdependence of complex components.

  • Altered protein synthesis and stability: Pulse-chase labeling experiments reveal that mutations can reduce the rate of labeling of cytochrome b6-f subunits and decrease their stability . PetD mutations would likely affect not only PetD itself but also other subunits like Cyt f, whose synthesis depends on proper PetD function.

  • Impact on photosynthetic efficiency: Given the essential role of the cytochrome b6-f complex in photosynthetic electron transport, mutations disrupting complex assembly or function would inevitably reduce photosynthetic efficiency, potentially limiting growth and development.

A systematic approach to studying specific petD mutations would involve site-directed mutagenesis targeting conserved residues, followed by comprehensive analysis of complex assembly, stability, and functional impact on electron transport rates.

How can researchers integrate petD studies with broader investigations of photosynthetic adaptations in Vitis vinifera?

Integrating petD studies with broader investigations of photosynthetic adaptations in Vitis vinifera requires a multidisciplinary approach connecting molecular mechanisms to physiological outcomes:

  • Environmental response studies: Building on research examining Vitis vinifera responses to elevated CO₂ , researchers can investigate how environmental factors affect petD expression and cytochrome b6-f complex assembly. This could involve tracking complex assembly under varied conditions using techniques like BN-PAGE combined with physiological measurements of photosynthetic efficiency.

  • Cultivar comparisons: The search results mention studies comparing different Vitis vinifera cultivars such as Riesling and Cabernet Sauvignon . Similar comparative approaches could reveal cultivar-specific differences in petD sequence, expression, or regulation that might contribute to variations in photosynthetic efficiency or environmental adaptability.

  • Developmental analysis: Studies could examine how petD expression and cytochrome b6-f complex assembly change throughout developmental stages. The tissue-specific expression analysis approaches described for other Vitis vinifera genes could be applied to petD, potentially revealing stage-specific regulation.

  • Integration with omics approaches: Combining targeted studies of petD with broader transcriptomic, proteomic, and metabolomic analyses could position cytochrome b6-f complex variations within the larger context of photosynthetic adaptation.

  • Field-to-laboratory pipeline: Establishing experimental systems that bridge controlled laboratory studies with field observations would enhance the relevance of findings. The VineyardFACE field trial mentioned in the search results represents an example of such systems, where molecular studies could be integrated with field-scale environmental manipulations.

This integrated approach would help establish connections between molecular variations in photosynthetic components like PetD and adaptive traits relevant to viticulture, potentially informing breeding strategies for climate resilience.

What computational approaches can be used to analyze PetD sequence conservation across plant species?

Computational analysis of PetD sequence conservation provides valuable insights into functional domains and evolutionary relationships. A comprehensive analytical framework would include:

This multi-faceted computational approach would reveal aspects of PetD that are fundamental to its function (highly conserved across species) versus those that might contribute to species-specific adaptations (variable regions).

How can quantitative techniques be used to measure PetD expression levels in different tissues or conditions?

Accurate quantification of PetD expression across different tissues or environmental conditions requires robust methodologies that address both transcript and protein levels:

  • Transcript-level analysis:

    • Quantitative real-time PCR (qRT-PCR): As described in search result , this technique can provide precise measurements of gene expression. For PetD, designing specific primers and using appropriate reference genes (such as Actin, mentioned in search result ) would be essential for reliable quantification.

    • Semi-quantitative RT-PCR (sqRT-PCR): This approach, also mentioned in search result , can be used for initial assessment of expression across multiple tissues. The search results describe using this method with cDNAs from various tissues including stem, root, leaf, tendril, alabastrum, flowers, pulp, pericarp, and ovules at different developmental stages .

  • Protein-level analysis:

    • Western blotting with calibrated standards: Using specific antibodies like those described in search result , western blotting with a dilution series of purified protein can provide quantitative data on PetD abundance.

    • Targeted proteomics approaches: Techniques like selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can provide highly sensitive and specific quantification of PetD protein.

  • Complex assembly analysis:

    • Blue Native-PAGE with immunodetection: This approach, used in search result , can quantify not just total PetD levels but its distribution across different assembly states (free protein, subcomplexes, full complex).

  • Experimental considerations:

    • Include appropriate normalization controls (like CF1β mentioned in search result )

    • Ensure consistent sample processing across conditions to avoid technical variations

    • Consider dynamic ranges of detection methods, especially when comparing tissues with potentially large differences in expression levels

This multi-level analysis provides a comprehensive view of PetD expression from gene to functional complex, essential for understanding its regulation in different contexts.

What control experiments are essential when studying PetD function and interactions?

Robust control experiments are crucial for ensuring the validity and interpretability of research on PetD function and interactions. Based on the search results and standard research practices, essential controls include:

  • Antibody validation controls:

    • Positive controls using known sources of PetD protein, as demonstrated in search result which showed antibody reactivity across multiple species

    • Concentration gradient tests to determine optimal antibody dilutions (e.g., the 1:1000 dilution recommended for western blotting )

    • Secondary antibody-only controls to detect non-specific binding

  • Protein interaction controls:

    • Input samples representing a fraction of the material used in immunoprecipitation experiments to verify the presence of proteins before pull-down

    • Multiple rounds of immunoprecipitation to ensure complete recovery of target proteins, as described in search result

    • Non-specific IgG controls to identify background binding in co-immunoprecipitation experiments

  • Protein synthesis and stability controls:

    • Time-course controls in pulse-chase experiments (e.g., 10-minute and 30-minute labeling periods as used in search result )

    • Translation inhibitor treatments (like lincomycin mentioned in search result ) with appropriate time-course sampling to assess protein stability

    • Loading controls like CF1β protein mentioned in search result for normalization across samples

  • Sample preparation controls:

    • Consistent protein extraction methods with appropriate buffers and protease inhibitors as detailed in search result

    • Standardized protein quantification methods (like the BCA assay mentioned in search result ) with BSA standards

    • Denaturation controls ensuring complete protein unfolding before SDS-PAGE (e.g., 10 minutes at 95°C in appropriate buffer )

  • Experimental validation:

    • Technical replicates to assess method reproducibility

    • Biological replicates to account for natural variation

    • Alternative methods to confirm key findings (e.g., validating protein interactions identified by co-immunoprecipitation with an independent technique)

Implementation of these control experiments ensures that observations regarding PetD function and interactions can be attributed to the biological phenomena under study rather than technical artifacts.

What are common issues in recombinant PetD expression and how can they be addressed?

Recombinant expression of membrane proteins like PetD presents several challenges, each requiring specific troubleshooting approaches:

  • Low expression yield:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solutions: Optimize codon usage for the expression host; use lower growth temperatures (20-25°C) to slow protein synthesis and aid folding; test inducible promoters with various induction strengths; consider specialized expression hosts designed for membrane proteins.

    • Evidence-based approach: Monitor expression at different time points after induction as described in search result , which mentions collecting samples every 12 hours after methanol induction.

  • Protein misfolding and aggregation:

    • Problem: Improper folding leading to inclusion body formation or degradation.

    • Solutions: Co-express with molecular chaperones; include membrane-mimetic environments during expression; express as a fusion with solubility-enhancing tags; reduce expression rate with lower inducer concentrations or lower temperatures.

    • Evidence-based approach: The search results suggest that PetD stability depends on interaction with cytochrome b6 , so co-expression with this partner might enhance proper folding.

  • Protein degradation:

    • Problem: Rapid degradation of the recombinant protein by host proteases.

    • Solutions: Include protease inhibitors during extraction and purification as mentioned in search result ; use protease-deficient host strains; optimize sample handling to minimize time at room temperature.

    • Evidence-based approach: Search result indicates newly synthesized proteins can have very short half-lives, highlighting the importance of protecting against degradation.

  • Improper membrane insertion:

    • Problem: Failure to properly integrate into membranes.

    • Solutions: Use appropriate signal sequences for the host; express in systems with compatible membrane insertion machinery; consider in vitro translation systems with supplied membranes.

    • Evidence-based approach: The dual requirement for proper folding and membrane insertion might explain the formation of assembly intermediates observed in search result .

  • Purification difficulties:

    • Problem: Challenges in extracting and purifying membrane proteins while maintaining native structure.

    • Solutions: Screen multiple detergents for optimal solubilization; use mild extraction conditions; consider native purification approaches like BN-PAGE described in search result ; implement gradient elution strategies to prevent protein aggregation.

    • Evidence-based approach: The gradient SDS-PAGE approach described in search result (8-16%) might be particularly suitable for membrane proteins like PetD.

Systematic optimization of these parameters, with careful monitoring at each step using techniques like western blotting with specific antibodies , can significantly improve recombinant PetD expression outcomes.

How can researchers distinguish between authentic interactions and artifacts when studying PetD interactions?

Distinguishing genuine PetD interactions from experimental artifacts requires rigorous experimental design and multiple validation approaches:

  • Employ reciprocal interaction verification:

    • If PetD co-immunoprecipitates with protein X, confirm that protein X also co-immunoprecipitates with PetD

    • Use multiple antibodies targeting different epitopes when available

    • The search results demonstrate how antibodies against different components (Cyt b6 and PetD) can be used to verify complex formation

  • Apply appropriate controls for non-specific binding:

    • Include isotype-matched control antibodies in immunoprecipitation experiments

    • Perform pull-downs with non-related proteins of similar properties

    • Pre-clear lysates to remove proteins with general "stickiness"

  • Validate interactions across multiple methods:

    • Complement co-immunoprecipitation with independent techniques like BN-PAGE, which has been successfully used to study cytochrome b6-f complex assembly

    • Use orthogonal approaches such as crosslinking followed by mass spectrometry

    • Consider proximity labeling approaches for in vivo interaction validation

  • Examine interaction dynamics:

    • Compare interactions under different conditions to identify those that respond to relevant physiological changes

    • Use time-course experiments, such as the pulse-chase labeling described in search result , to distinguish stable from transient interactions

    • Test interactions in the presence of specific inhibitors or competitors

  • Consider detergent effects:

    • Different detergents can either preserve or disrupt protein-protein interactions

    • Test multiple detergent conditions and concentrations

    • Compare results with detergent-free approaches when possible

  • Quantitative assessment:

    • Calculate enrichment factors for potential interactors compared to controls

    • Use statistical approaches to identify interactions significantly above background

    • Consider stoichiometric relationships between interacting proteins

By implementing these approaches, researchers can build a high-confidence interaction network for PetD that distinguishes biologically meaningful interactions from experimental artifacts.

What strategies can overcome challenges in studying PetD in the context of whole-plant photosynthetic phenotypes?

Connecting molecular studies of PetD to whole-plant photosynthetic phenotypes presents several challenges that require integrative experimental strategies:

  • Bridge molecular and physiological measurements:

    • Combine molecular analyses of PetD (expression, complex assembly) with concurrent measurements of photosynthetic parameters (CO₂ assimilation, electron transport rates, chlorophyll fluorescence)

    • Implement time-course studies to capture both rapid responses and long-term adaptations

    • The VineyardFACE experimental system mentioned in search result demonstrates how controlled environmental manipulations can be combined with detailed plant measurements

  • Develop appropriate genetic resources:

    • Generate plants with altered PetD expression or sequence through approaches like RNAi, CRISPR/Cas9, or overexpression

    • Create reporter lines that allow visualization of PetD expression patterns

    • Establish populations that capture natural variation in PetD sequence or expression for association studies

  • Implement non-destructive monitoring:

    • Utilize chlorophyll fluorescence imaging to non-destructively track photosynthetic efficiency over time

    • Apply hyperspectral imaging techniques to detect photosynthetic signatures at the whole-plant level

    • Develop sampling strategies that minimize impact on plant development while providing sufficient material for molecular analyses

  • Account for developmental and environmental heterogeneity:

    • Standardize sampling by leaf position, developmental stage, and time of day

    • Consider microenvironmental variations within experimental systems

    • The detailed tissue sampling approach described in search result , which examined expression across multiple tissues and developmental stages, provides a model for comprehensive analysis

  • Integrate with broader systems biology approaches:

    • Contextualize PetD studies within larger transcriptomic, proteomic, and metabolomic datasets

    • Develop network models connecting molecular changes to physiological outputs

    • Consider interactions with other photosynthetic complexes and regulatory networks

  • Establish field-relevant experimental systems:

    • Design experiments that balance controlled conditions with agricultural relevance

    • Include multiple cultivars like the Riesling and Cabernet Sauvignon comparison in search result

    • Test responses to realistic environmental fluctuations rather than static conditions

These integrative approaches help overcome the challenge of connecting molecular mechanisms to whole-plant phenotypes, providing a more complete understanding of PetD's role in Vitis vinifera photosynthesis and productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.