Recombinant Vitis vinifera Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Role

Cytochrome b6 (petB) is a transmembrane protein integral to the Cyt b6f complex. It binds three prosthetic groups: two b-type hemes and a uniquely bound heme c<sub>n</sub> . The recombinant version from Vitis vinifera corresponds to a partial sequence (1–215 amino acids) fused with a His tag for purification . Key structural features include:

  • Molecular Weight: ~24 kDa (predicted) .

  • Domains: Hydrophobic helices facilitating quinone/quinol binding and electron transfer .

  • Post-Translational Modifications: Requires covalent heme attachment via the CCB pathway for stability .

Production and Purification

Recombinant Vitis vinifera cytochrome b6 is produced in heterologous systems for research purposes:

ParameterDetails
Expression SystemE. coli or baculovirus
TagHis tag (type determined during production)
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; -20°C/-80°C (lyophilized form)
ReconstitutionSterile water to 0.1–1.0 mg/mL; avoid repeated freeze-thaw cycles

Functional Insights from Research

  • Electron Transport: Mediates plastoquinol oxidation and plastocyanin reduction, critical for linear and cyclic electron flow .

  • Mutant Studies: Loss of Cyt b6 destabilizes the Cyt b6f complex, reducing photosynthetic efficiency by 70% in cyanobacteria .

  • State Transitions: Required for balancing energy distribution between PSI and PSII in response to light conditions .

Research Applications

  • Enzyme Activity Assays: Used to study quinone-binding kinetics and inhibitor interactions (e.g., DBMIB) .

  • Structural Studies: Aids in resolving Cryo-EM structures of the Cyt b6f complex .

  • Mutagenesis Analysis: Investigating heme-binding residues (e.g., Cys-35) and assembly factors like HCF222 .

Key Challenges and Advances

  • Stability Issues: Apocytochrome b6 degrades rapidly without heme c<sub>n</sub> attachment, necessitating co-expression with CCB factors .

  • Heterologous Expression: Baculovirus systems yield higher protein quantities but require optimization for transmembrane domain folding .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex, which facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: vvi:4025129

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Vitis vinifera Cytochrome b6 (petB) and where is it found in the plant?

Cytochrome b6 (petB) is a protein subunit of the cytochrome b6f complex, which plays a crucial role in the photosynthetic electron transport chain in the chloroplasts of Vitis vinifera (grape). The protein is encoded by the petB gene located in the chloroplast genome . This gene is part of the larger chloroplast genome in Vitis vinifera, which spans 160,928 base pairs in total length . The cytochrome b6f complex serves as an electron transfer intermediary between photosystem II and photosystem I, making it essential for photosynthetic function and energy production in grape plants.

The protein consists of 215 amino acids with a specific sequence beginning with MSKVYDWFEERLEIQAIAD and contains various functional domains critical for its electron transport capabilities . Within the chloroplast, the cytochrome b6 protein is embedded in the thylakoid membrane, where it participates in proton pumping across the membrane, contributing to the establishment of the proton gradient necessary for ATP synthesis.

How is the petB gene organized in the chloroplast genome of Vitis vinifera?

The petB gene in Vitis vinifera is part of the larger chloroplast genome, which has a typical quadripartite structure consisting of a large single-copy region (LSC), a small single-copy region (SSC), and two inverted repeat regions (IR) . Specifically, the complete chloroplast genome of Vitis vinifera is 160,928 bp in length, which is slightly longer than related grape varieties such as Saperavi (160,927 bp) and Meskhuri mtsvane (160,906 bp) .

The chloroplast genome of Vitis vinifera contains 113 unique genes, with 18 duplicated in the inverted repeat regions, bringing the total gene count to 131 . These include four ribosomal RNA genes and 30 distinct tRNA genes . The petB gene is among the protein-coding genes that contribute to photosynthetic machinery.

Unlike some cyanobacterial counterparts, the petB gene in higher plants like Vitis vinifera lacks an amino-terminal extension of seven amino acids that is found in non-nitrogen-fixing unicellular cyanobacteria . Additionally, while the cyanobacterial version undergoes posttranslational removal of three amino acids from the amino terminus, the structure of petB in Vitis vinifera shows different processing patterns .

What are the optimal storage conditions for recombinant Vitis vinifera Cytochrome b6?

For optimal preservation of biological activity, recombinant Vitis vinifera Cytochrome b6 requires specific storage conditions. The protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized for this particular protein . Long-term storage should be at -20°C, and for extended preservation, storage at -80°C is recommended .

To maintain protein integrity, it is crucial to avoid repeated freezing and thawing cycles, as this can lead to protein denaturation and loss of functionality . For ongoing experiments over a short period, working aliquots can be stored at 4°C for up to one week . This approach minimizes the need for multiple freeze-thaw cycles while ensuring that the protein remains stable during the experimental timeframe.

The storage recommendations are particularly important given the complex membrane-associated nature of this protein and its critical redox properties that need to be preserved for experimental validity.

How do the structure and function of petB in Vitis vinifera compare with those in other photosynthetic organisms?

The petB gene in Vitis vinifera exhibits notable differences when compared to its counterparts in other photosynthetic organisms, particularly cyanobacteria. One significant distinction is in the amino-terminal region. While non-nitrogen-fixing unicellular cyanobacteria like Synechocystis sp. PCC 6803 possess an amino-terminal extension of seven amino acids, this extension is absent in higher plants including Vitis vinifera . This structural difference has implications for protein processing and potentially for function within the photosynthetic apparatus.

Another important distinction involves the presence of introns. The cyanobacterial petB sequence lacks introns after the first amino acids, whereas higher plant petB sequences often contain introns . These differences reflect the evolutionary divergence between prokaryotic cyanobacteria and eukaryotic chloroplasts, despite their shared evolutionary history through endosymbiosis.

What redox properties characterize Cytochrome b6, and how can researchers effectively measure these properties?

Cytochrome b6 exhibits complex redox behavior characterized by multiple redox centers. While the specific redox properties of Vitis vinifera Cytochrome b6 are not directly detailed in the search results, comparative analysis with related cytochromes provides valuable insights. Similar cytochromes b from plant plasma membranes typically display two apparent midpoint redox potentials, often in the range of approximately +135 to +236 mV .

To effectively measure these redox properties, researchers can employ potentiometric redox titrations. This methodology requires fitting the experimental data to a Nernst equation incorporating two redox centers . The technique involves systematic adjustment of the ambient redox potential while monitoring changes in the spectroscopic properties of the protein, particularly absorbance changes associated with the oxidation and reduction of the heme groups.

Electron paramagnetic resonance (EPR) spectroscopy represents another powerful tool for characterizing the redox centers. EPR can reveal characteristic signals, such as the highly axial low-spin (HALS) species with g = 3.3, which is compatible with His-Met coordinated heme . This spectroscopic signature provides valuable information about the coordination environment of the heme group.

For a comprehensive characterization, researchers should combine multiple analytical approaches, including:

  • Potentiometric redox titrations to determine midpoint potentials

  • EPR spectroscopy to characterize the coordination environment

  • UV-visible spectroscopy to monitor redox state transitions

  • Protein structural analysis to identify conserved heme-coordinating residues

How can recombinant Vitis vinifera Cytochrome b6 be applied in phylogenetic and diversity studies of grapevine species?

Recombinant Vitis vinifera Cytochrome b6, encoded by the chloroplast petB gene, serves as a valuable molecular marker for phylogenetic and diversity studies of grapevine species. Chloroplast genome analysis, including petB and other chloroplast genes, has proven effective for elucidating the evolutionary relationships among different Vitis species and varieties .

Researchers can utilize the following methodological approaches:

The genetic characterization resulting from these approaches can lead to the discovery of unique traits valuable for breeding programs focused on disease resistance, climate adaptability, and agronomic performance . This information enables more informed selection of parental varieties and improved cultivar development.

What experimental challenges exist when working with recombinant Cytochrome b6, and how can they be addressed?

Working with recombinant Cytochrome b6 presents several experimental challenges that researchers must navigate to obtain reliable results. These challenges and their potential solutions include:

  • Protein stability issues:
    Cytochrome b6 can be prone to denaturation during storage and experimental manipulation. To address this, researchers should store the protein in an optimized Tris-based buffer with 50% glycerol at -20°C or -80°C . Working aliquots should be kept at 4°C for no more than one week, and repeated freeze-thaw cycles must be avoided .

  • Maintaining redox properties:
    Preserving the native redox properties is crucial for functional studies. Researchers should include appropriate reducing agents in buffers when necessary and conduct experiments under controlled atmospheric conditions to prevent unwanted oxidation. The redox properties of Cytochrome b6 can be monitored using spectroscopic methods to ensure the protein remains in the desired redox state throughout experiments.

  • Experimental reproducibility:
    Ensuring reproducible results requires rigorous standardization of experimental protocols. Researchers should adopt practices like pre-registration of experimental designs, clear documentation of methodology, and sharing of raw data and analysis code . Implementation of containerized workflows and standardized processing pipelines can significantly enhance reproducibility .

  • Expression and purification optimization:
    Recombinant expression systems may not always produce properly folded and active Cytochrome b6. Optimization strategies include:

    • Testing multiple expression systems (bacterial, yeast, insect cells)

    • Co-expressing chaperones to assist proper folding

    • Optimizing induction conditions (temperature, inducer concentration, duration)

    • Developing purification protocols that maintain the heme cofactor association

  • Functional validation:
    Confirming that the recombinant protein maintains native activity is essential. Functional assays should be established to verify electron transport capabilities, often involving spectroscopic measurements of redox transitions or reconstitution into membrane systems.

What methodological approaches are most effective for studying interactions between Cytochrome b6 and other components of the photosynthetic electron transport chain?

Investigating the interactions between Cytochrome b6 and other components of the photosynthetic electron transport chain requires sophisticated methodological approaches. The following techniques are particularly effective:

  • Co-immunoprecipitation (Co-IP) assays:
    Co-IP can identify protein-protein interactions between Cytochrome b6 and other components of the electron transport chain. This approach involves using antibodies specific to Cytochrome b6 to precipitate the protein along with its binding partners, followed by identification using techniques such as mass spectrometry.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE):
    BN-PAGE is valuable for analyzing intact protein complexes under native conditions. This technique preserves the interactions between Cytochrome b6 and other components of the cytochrome b6f complex, allowing researchers to study the assembly and stability of the full complex.

  • Förster resonance energy transfer (FRET):
    FRET can be used to detect proximity between Cytochrome b6 and other proteins within the electron transport chain. By labeling Cytochrome b6 and potential interaction partners with appropriate fluorophores, researchers can measure energy transfer as an indicator of protein-protein interactions in real-time.

  • Electron paramagnetic resonance (EPR) spectroscopy:
    EPR can provide detailed information about the redox centers and their interactions. The technique can detect the HALS signal with g = 3.3 characteristic of His-Met coordinated heme, similar to what has been observed in related proteins . EPR can reveal how these centers interact with other components of the electron transport chain.

  • Reconstitution experiments:
    Reconstituting purified Cytochrome b6 with other components of the electron transport chain in artificial membrane systems allows for controlled study of these interactions. This approach can be combined with kinetic measurements to assess electron transfer rates and dependencies.

  • Structural biology approaches:
    X-ray crystallography or cryo-electron microscopy of Cytochrome b6 alone or in complex with interaction partners can provide atomic-level insights into the structural basis of these interactions. Information from crystallographic structures, such as those of DOMON domains in related proteins that include a single high-potential heme b coordinated by specific Met and His residues, can guide interpretation of the structural data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.