Recombinant Vitis vinifera NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vitis vinifera NAD(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

The compound "Recombinant Vitis vinifera NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)" refers to a specific type of enzyme found in Vitis vinifera (grapevine), which has been produced using recombinant DNA technology. NAD(P)H-quinone oxidoreductases (NDH) are enzymes that catalyze the transfer of electrons from NAD(P)H to quinones . These enzymes are vital in various metabolic processes, including photosynthesis and antioxidant defense mechanisms in plants . The "chloroplastic" part of the name indicates that this particular enzyme is located in the chloroplast, the organelle responsible for photosynthesis .

Function and Significance

NDH complexes play a crucial role in the photosynthetic electron transport chain within the chloroplasts of plants .

Key functions include:

Vitis vinifera and its properties

Vitis vinifera, or the common grapevine, is known for producing various bioactive compounds, including resveratrol, gallic acid, catechin, and quercetin . Extracts from Vitis vinifera have demonstrated antioxidant properties and protective effects against oxidative stress in cellular models .

Role of NDC1 in Plastoquinone Redox State

NAD(P)H dehydrogenase C1 (NDC1) affects the redox state of the total plastoquinone (PQ) pool in vivo by reducing the plastoquinone reservoir of plastoglobules . Additionally, NDC1 is required for normal plastochromanol-8 accumulation and is essential for vitamin K1 production .

Research Findings

  • Purified plastoglobules functioned as a quinone-containing substrate and accepted electrons from NADPH and the recombinant NDC1 enzyme in vitro .

  • The PQ pool was significantly more oxidized in the ndc1 mutant than in the wild type .

Potential applications

Understanding the function and properties of Recombinant Vitis vinifera NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) can have several potential applications:

  • Enhancing Photosynthesis: By manipulating the activity of NDH complexes, it may be possible to improve the efficiency of photosynthesis in plants, leading to increased crop yields.

  • Improving Stress Tolerance: Enhancing the antioxidant defense mechanisms involving NDH enzymes could help plants better withstand environmental stresses such as drought, heat, and pollution.

  • Pharmaceutical and Nutraceutical Applications: The antioxidant properties of Vitis vinifera extracts, mediated in part by NDH enzymes, could be harnessed for developing new pharmaceutical and nutraceutical products .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFFISGVLAPISKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains. This process utilizes FMN and iron-sulfur (Fe-S) centers. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Database Links

KEGG: vvi:4025143

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ndhC in Vitis vinifera chloroplasts?

The ndhC gene is one of the 79 protein-coding genes found in the chloroplast genome of Vitis vinifera. The complete chloroplast genome of Vitis vinifera is a circular DNA molecule with 160,928 base pairs, which is longer than some related species . The chloroplast genome consists of large and small unique regions separated by two inverted repeat regions (IRa and IRb) .

The chloroplast genome of Vitis vinifera has a relatively low GC content, which is a significant feature of plastidic genomes. This characteristic is believed to have formed after endosymbiosis through DNA replication and repair mechanisms . Understanding this genomic context is crucial for designing primers and experimental approaches for isolating and studying the ndhC gene.

What is the function of ndhC in grapevine chloroplasts?

The ndhC gene encodes subunit 3 of the NAD(P)H-quinone oxidoreductase complex (NDH complex) located in the chloroplast thylakoid membrane. This complex plays several critical roles in plant physiology:

  • Participates in cyclic electron flow around photosystem I

  • Facilitates chlororespiration

  • Contributes to plant responses to various environmental stresses

  • Aids in optimizing photosynthetic efficiency under changing light conditions

The NDH complex, including the ndhC subunit, is particularly important during developmental transitions and stress responses in grapevines, as evidenced by transcriptome studies across different developmental stages . Expression levels of ndhC and related genes show significant variation during fruit development, suggesting their roles extend beyond basic photosynthetic functions.

How can I isolate the ndhC gene from Vitis vinifera for recombinant expression?

Isolation of the ndhC gene from Vitis vinifera typically follows these methodological steps:

  • Sample collection and RNA extraction: Collect fresh grape tissue (preferably young leaves with active photosynthesis) and extract total RNA using a plant RNA isolation kit.

  • cDNA synthesis: Perform reverse transcription to generate cDNA using oligo(dT) primers or random hexamers.

  • PCR amplification: Design specific primers for the ndhC gene based on the published chloroplast genome sequence of Vitis vinifera (accession number NC_007957.1) . Include appropriate restriction enzyme sites for subsequent cloning.

  • Cloning and verification: Clone the PCR product into a suitable expression vector and verify by sequencing.

For successful isolation, consider the following optimization steps:

  • Use tissue from different developmental stages as expression may vary

  • Try multiple primer combinations targeting conserved regions

  • Include positive controls using known chloroplast genes

What expression systems are most effective for recombinant production of Vitis vinifera ndhC?

Several expression systems have been evaluated for the recombinant production of chloroplastic proteins like ndhC, each with distinct advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)Post-translational Modifications
E. coli BL21(DE3)High yield, rapid growthLimited PTMs, inclusion body formation5-15Minimal
Pichia pastorisProper folding, moderate yieldLonger production time3-8Partial
Plant-based (N. benthamiana)Native-like processingLower yield, complex purification0.5-2Complete
Cell-free systemToxic protein compatibleHigher cost, lower yield0.3-1Customizable

The methodological approach should include:

  • Codon optimization for the chosen expression system

  • Inclusion of purification tags that don't interfere with protein function

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Evaluation of multiple solubilizing conditions

What purification strategies optimize yield and activity of recombinant ndhC?

Purification of recombinant ndhC presents challenges due to its membrane-associated nature. A methodological approach should include:

  • Membrane protein extraction: Use mild detergents (DDM, LDAO, or Triton X-100) to solubilize the protein from membranes without denaturation.

  • Affinity chromatography: Employ histidine or other affinity tags for initial capture, with optimized imidazole gradients to reduce non-specific binding.

  • Size exclusion chromatography: Further purify the protein and assess oligomeric state.

  • Activity preservation: Include stabilizing agents throughout purification:

    • 10-15% glycerol

    • Reducing agents (1-5 mM DTT or β-mercaptoethanol)

    • Appropriate detergent concentrations above CMC

Yield and activity optimization often requires balancing multiple factors:

Purification StepCritical ParametersOptimization StrategyTypical Recovery (%)
Cell lysisDetergent type, concentrationScreen multiple detergents70-85
Affinity bindingImidazole concentration, flow rateStep vs. gradient elution60-75
Size exclusionBuffer composition, pHAddition of stabilizers80-90
ConcentrationMembrane material, speedStaged concentration with mixing70-80

How can I validate the functional activity of purified recombinant ndhC?

Functional validation of ndhC requires multiple complementary approaches:

  • Spectrophotometric assays: Measure NAD(P)H oxidation rates by monitoring absorbance decrease at 340 nm in the presence of various quinone acceptors.

  • Electron transport measurements: Use artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP) to assess electron flow.

  • Reconstitution experiments: Incorporate purified ndhC into liposomes or nanodiscs and measure proton gradient formation.

  • Binding assays: Evaluate interactions with other NDH complex subunits using techniques such as:

    • Surface plasmon resonance

    • Isothermal titration calorimetry

    • Co-immunoprecipitation

Typical activities for properly folded recombinant ndhC should show enzyme kinetics with Km values for NADH in the 10-50 μM range and Vmax values that can be compared to native complex activities extracted from chloroplasts.

How do I analyze sequence variations in ndhC across different Vitis vinifera cultivars?

Analysis of ndhC sequence variations across Vitis vinifera cultivars requires both bioinformatic and experimental approaches:

  • Database mining: Extract ndhC sequences from publicly available chloroplast genomes of different cultivars.

  • Alignment and polymorphism identification: Use tools like MUSCLE or ClustalW for alignment followed by SNP identification.

  • Structural impact assessment: Map variations onto predicted protein structures to evaluate potential functional impacts.

  • Experimental validation: Design cultivar-specific primers to amplify and sequence ndhC from new samples.

For molecular marker development, simple sequence repeats (SSRs) and single nucleotide polymorphisms (SNPs) can be particularly useful. The chloroplast genomes of Vitis vinifera contain approximately 74 SSRs that are valuable for genetic diversity studies . These markers exhibit high discriminatory power with 13-23 alleles per locus across cultivars .

When analyzing sequence data, consider:

  • Differentiation between synonymous and non-synonymous substitutions

  • Evaluation of selection pressure using Ka/Ks ratios

  • Assessment of conservation patterns in functional domains

How can I integrate transcriptomic data to understand ndhC expression patterns during grape development?

Integration of transcriptomic data for understanding ndhC expression requires systematic analysis:

  • Data collection: Gather RNA-seq datasets from different developmental stages, such as the enlargement period (40 DAP), color transition period (80 DAP), and maturity period (120 DAP) .

  • Normalization and expression quantification: Calculate Transcripts Per Million (TPM) values to allow comparison across datasets .

  • Differential expression analysis: Use statistical tools like DESeq to identify significant changes in expression levels (p-value <0.05 and |log2(fold change)| > 1) .

  • Co-expression network analysis: Identify genes with similar expression patterns to ndhC to understand functional relationships.

From studies of Chardonnay cultivars across different ecological zones in Ningxia, China, significant expression changes have been observed throughout fruit development . These changes correlate with metabolic shifts in soluble sugars, total phenols, and anthocyanins accumulation.

To properly interpret expression data:

  • Consider tissue-specific expression patterns

  • Account for environmental factors across different ecological zones

  • Correlate expression changes with physiological transitions

What statistical approaches should I use when analyzing the impact of environmental factors on ndhC function?

When analyzing environmental impacts on ndhC function, robust statistical designs are essential:

  • Experimental design: Implement a randomized complete block design (RCBD) for field trials to minimize environmental variation unrelated to treatments .

  • Blocking strategies: Establish relatively homogeneous regions within vineyards as blocks, with each block receiving all treatments assigned randomly .

  • Replication requirements: Include at least three biological replicates per treatment, with 15 uniformly sized fruits in each replicate for transcriptomic studies .

  • Statistical analysis methods:

    • ANOVA with post-hoc tests for comparing treatments

    • Mixed-effects models to account for random environmental factors

    • Principal component analysis to identify major sources of variation

    • Multiple regression to model relationships between environmental factors and ndhC function

For vineyard experiments, it's crucial to consider the scale of each treatment and the physical and temporal plan for sampling before starting . Data analysis and interpretation are only as accurate as the experimental design allows.

Why might recombinant ndhC show low expression levels or form inclusion bodies?

Low expression or inclusion body formation with recombinant ndhC can result from several factors:

  • Codon usage bias: The chloroplast genome of Vitis vinifera has a low GC content, which is a significant feature of plastidic genomes . This can result in codon usage incompatible with bacterial expression systems.

  • Membrane protein nature: As a subunit of the NDH complex embedded in thylakoid membranes, ndhC has hydrophobic regions that can cause aggregation during expression.

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membrane integrity.

Methodological solutions include:

ChallengeTroubleshooting ApproachExpected Improvement
Codon biasSynthesize codon-optimized gene2-5 fold increase in expression
Inclusion bodiesLower induction temperature (16-20°C)30-50% increase in soluble fraction
Membrane protein aggregationAdd membrane-mimicking detergents40-60% improvement in soluble yield
Host toxicityUse tunable promoters or C41/C43 E. coli strainsEnables expression of previously toxic constructs
Protein instabilityInclude stabilizing ligands during expression20-30% increase in recovered protein

For challenging cases, consider fusion partners specifically designed for membrane proteins or cell-free expression systems that bypass host cell toxicity issues.

How can I optimize antibody production against ndhC for immunodetection methods?

Generating effective antibodies against ndhC requires careful antigen design and validation:

  • Epitope selection:

    • Analyze the ndhC sequence for hydrophilic, surface-exposed regions

    • Avoid transmembrane domains that are poorly immunogenic

    • Consider synthesizing peptides from N or C-terminal regions

  • Antigen preparation options:

    • Recombinant protein fragments expressed in E. coli

    • Multiple antigenic peptide (MAP) constructs

    • KLH or BSA-conjugated synthetic peptides

  • Antibody production strategy:

    • Polyclonal: Faster production but potentially lower specificity

    • Monoclonal: Longer development time but consistent specificity

    • Recombinant antibodies: Alternative for difficult antigens

  • Validation methods:

    • Western blotting against recombinant protein and native extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunolocalization in plant tissues with appropriate controls

For chloroplastic proteins like ndhC, it's crucial to confirm antibody specificity against both the recombinant protein and native protein from Vitis vinifera chloroplast extracts.

What approaches can address challenges in measuring electron transport activity of reconstituted ndhC?

Measuring electron transport activity of reconstituted ndhC presents several technical challenges that can be addressed methodologically:

  • Enzyme stability issues:

    • Include stabilizing agents (glycerol, reducing agents) in assay buffers

    • Perform assays immediately after purification

    • Screen detergent types and concentrations for optimal activity maintenance

  • Signal-to-noise optimization:

    • Use specialized assay formats (stopped-flow spectroscopy)

    • Incorporate fluorescent probes for membrane potential

    • Employ oxygen electrodes for more direct measurement of electron transport

  • Reconstitution approaches:

    • Test proteoliposomes with different lipid compositions

    • Utilize nanodiscs with varied scaffold proteins

    • Evaluate co-reconstitution with other NDH complex subunits

  • Controls and validation:

    • Include specific inhibitors (rotenone, piericidin A)

    • Compare with purified thylakoid membranes

    • Perform parallel measurements with alternative electron acceptors

Typical troubleshooting approaches include systematic variation of pH, ionic strength, and substrate concentrations to identify optimal assay conditions.

How might CRISPR/Cas9 technology be applied to study ndhC function in Vitis vinifera?

CRISPR/Cas9 technology offers powerful approaches for studying ndhC function in Vitis vinifera:

  • Knockout strategies: Generate targeted knockouts of ndhC to assess physiological impacts on:

    • Photosynthetic efficiency under fluctuating light

    • Stress response mechanisms

    • Growth and development parameters

  • Base editing approaches: Introduce specific point mutations to study structure-function relationships without complete gene disruption.

  • Methodological considerations:

    • Design multiple sgRNAs targeting conserved regions of ndhC

    • Utilize Agrobacterium-mediated transformation for grapevine genetic modification

    • Employ tissue culture protocols optimized for grapevine regeneration

    • Implement screening methods to identify successful transformants

  • Validation strategies:

    • PCR-based genotyping of regenerated plants

    • RNA-seq to confirm transcript absence/modification

    • Phenotypic characterization under normal and stress conditions

The chloroplast genome is typically maternally inherited, which presents both challenges and opportunities for chloroplastic gene editing. Alternative approaches may include nuclear-encoded synthetic versions of ndhC with chloroplast targeting sequences.

What bioinformatic approaches can predict protein-protein interactions involving ndhC in the NDH complex?

Advanced bioinformatic approaches for predicting ndhC interactions include:

  • Structural modeling:

    • Homology modeling based on related bacterial complex structures

    • Ab initio protein folding for unique regions

    • Molecular dynamics simulations to assess stability

  • Interaction prediction algorithms:

    • Sequence-based methods (correlated mutations, conserved interfaces)

    • Structure-based docking simulations

    • Machine learning approaches trained on known membrane protein complexes

  • Evolutionary analysis:

    • Phylogenetic profiling across species

    • Co-evolution mapping of interacting residues

    • Comparative analysis across Vitis species and cultivars

The chloroplast genome of Vitis vinifera has been well characterized with 131 genes identified . Cross-referencing this data with transcriptomic studies across developmental stages can provide insights into which genes may functionally interact with ndhC .

How can multi-omics approaches enhance our understanding of ndhC regulation in response to environmental stresses?

Multi-omics approaches provide comprehensive insights into ndhC regulation:

  • Integration strategies:

    • Correlate transcriptomics, proteomics, and metabolomics data

    • Map changes onto known signaling and metabolic pathways

    • Identify regulatory networks through systems biology approaches

  • Experimental design considerations:

    • Implement randomized complete block design for field experiments

    • Include multiple ecological zones to capture environmental variation

    • Sample across developmental stages and stress conditions

  • Data analysis frameworks:

    • Use multivariate statistical methods to identify correlations

    • Apply machine learning for pattern recognition

    • Develop predictive models of gene-environment interactions

Studies of Chardonnay cultivars from six ecological zones in Ningxia, China demonstrated that integrating transcriptomic data across different developmental stages (40, 80, and 120 DAP) can reveal regulatory networks controlling important quality traits . Similar approaches could be applied to understand ndhC regulation in response to specific environmental stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.