Recombinant Vitis vinifera NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast Metabolism

2.1 Biochemical Activity
ndhE is a subunit of the NDH complex, which:

  • Shuttles Electrons: Transfers electrons from NAD(P)H to plastoquinone, bypassing the cytochrome bc₁ complex .

  • Supports Cyclic Electron Flow (CEF): Enhances ATP production under stress conditions (e.g., low light, high CO₂) by regenerating NADPH .

Enzymatic Classification

EC NumberReaction
EC 7.1.1.2NADH:ubiquinone reductase (H⁺-translocating)

Research Applications and Experimental Data

3.1 Expression and Purification
Recombinant ndhE is produced via E. coli fermentation and purified using nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography . Purity is confirmed by SDS-PAGE and Western blotting .

Functional Studies

  • Subunit Interactions: The NDH complex comprises 29 subunits, including ndhE, ndhG, and ndhH . Structural studies (e.g., EMDB-31307) reveal its integration into the complex’s quinone-binding domain .

  • Kinetic Analysis: Mutagenesis studies in analogous systems (e.g., NAD(P)H:quinone oxidoreductase) suggest subunits function cooperatively or independently depending on electron acceptor type .

Comparative Analysis of NDH Subunits

The NDH complex includes multiple subunits with distinct roles. Below is a comparison of key subunits:

SubunitRoleMolecular Weight (kDa)Source Organism
ndhEElectron transfer from NAD(P)H11.2 Vitis vinifera
ndhGQuinone-binding domain19.6 Vitis vinifera
ndhHProton translocation44.6 Hordeum vulgare

Key Research Findings

  1. Tissue-Specific Expression: ndhE homologs in Arabidopsis thaliana are expressed in photosynthetic tissues, correlating with CEF activity .

  2. Stress Adaptation: Overexpression of NDH subunits enhances plant resilience to environmental stressors by modulating redox balance .

  3. Mechanistic Insights: Structural studies of the NDH complex (e.g., EMDB-31307) highlight ndhE’s role in quinone reduction and proton pumping .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you require a specific format, kindly specify it in your order remarks. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; GSVIVT00013262001; VIVICP076; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic chain, potentially also in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. NDH couples the redox reaction with proton translocation, conserving the redox energy within a proton gradient.
Database Links

KEGG: vvi:4025041

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How should recombinant ndhE protein be stored for optimal stability?

For optimal stability of recombinant Vitis vinifera ndhE protein, storage recommendations include:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C in Tris-based buffer with 50% glycerol optimized specifically for this protein

  • Extended storage: For longer periods, conservation at -80°C is recommended

  • Handling protocol: Avoid repeated freezing and thawing cycles as this significantly reduces protein stability and activity

Proper storage is crucial for maintaining the structural integrity and functionality of the protein for experimental applications. The inclusion of glycerol acts as a cryoprotectant that helps prevent denaturation during freeze-thaw cycles.

What sequence databases contain information about Vitis vinifera ndhE?

Researchers can access Vitis vinifera ndhE sequence information through several databases:

DatabaseIdentifierInformation TypeAccess Method
UniProtQ0ZIW6Protein sequence, function annotationDirect search with accession number
Vitis GenomeGSVIVT00013262001Genomic contextGenome browser interface
Chloroplast DBVIVICP076Organelle-specific dataSpecialized plant organelle database

When navigating these resources, researchers should verify they are accessing information specifically for the chloroplastic form of the protein, as nuclear-encoded homologs may exist with different properties and functions .

How can I design an optimal extraction protocol for Vitis vinifera proteins including ndhE?

Designing an optimal extraction protocol for Vitis vinifera proteins including ndhE requires careful consideration of multiple experimental variables. Based on D-optimal experimental design approaches used for Vitis vinifera extractions, researchers should consider:

  • Plant material selection:

    • Source variability (different cultivars show varying protein expression profiles)

    • Tissue type (chloroplast-rich tissues like mature leaves are preferred for ndhE)

    • Developmental stage (affects protein abundance and modification state)

  • Extraction conditions optimization:

    • Solvent composition (ratio of ethanol can be varied from 0-100%)

    • Extraction temperature (typically tested between 25-80°C)

    • Buffer pH (affects protein stability and solubility)

  • Experimental design implementation:

    • Use statistical design software (e.g., Modde) to generate a D-optimal experimental matrix

    • Include at least 18 different single experiments plus 3 replicated runs

    • Analyze results using appropriate response variables (protein yield, activity, purity)

This systematic approach allows researchers to determine the optimal extraction conditions with minimal experimental runs while capturing key interaction effects between variables.

What expression systems are most effective for producing functional recombinant ndhE protein?

The expression of functional recombinant ndhE requires selecting an appropriate heterologous system. Based on successful approaches with other Vitis vinifera proteins:

  • Bacterial expression systems:

    • Escherichia coli remains the most commonly used first-line system

    • BL21(DE3) or C41/C43 strains are preferred for membrane proteins

    • Expression typically requires optimization of induction temperature (often lowered to 16-20°C) and IPTG concentration

  • Yeast expression alternatives:

    • Pichia pastoris offers advantages for membrane proteins like ndhE

    • Provides eukaryotic post-translational modifications

    • Growth in minimal media allows for controlled induction

  • Practical implementation:

    • For initial expression trials, researchers should include solubility tags (MBP, SUMO)

    • Codon optimization for the host organism is essential

    • Expression verification using Western blotting with anti-His tag antibodies

Studies with other Vitis vinifera recombinant proteins have successfully employed E. coli expression systems for functional studies, demonstrating this approach is viable when properly optimized .

How can contradictory research findings about ndhE be reconciled systematically?

When faced with contradictory findings in ndhE research, systematic reconciliation approaches include:

This approach has demonstrated an F-score of 0.56 in detecting genuine contradictions, with particularly strong performance (F-score of 0.67) for categorical characteristics, offering a methodological framework that can be applied to ndhE research conflicts .

What role might ndhE play in plant response to environmental stresses?

As a component of the chloroplastic electron transport system, ndhE likely plays significant roles in plant stress responses:

  • Cold stress response mechanisms:

    • Similar to dehydrins in Vitis vinifera, ndhE expression may be induced by low temperature

    • The protein potentially contributes to maintaining photosynthetic electron flow under cold conditions

    • Functional analysis should examine cis-regulatory elements in the gene promoter related to cold response

  • Drought response involvement:

    • NAD(P)H dehydrogenase activity helps maintain energy production under water limitation

    • Modified electron flow patterns may protect photosystems from damage during drought

    • Experimental approaches could compare wild-type versus ndhE-modified plants under controlled water limitation

  • Protective mechanisms:

    • The protein may contribute to cryoprotective effects similar to those observed with dehydrins

    • It potentially plays a role in maintaining chloroplast membrane integrity under stress

    • In vitro assays using purified recombinant protein can test protective effects on model enzymes

Understanding these stress-response functions has implications for improving grape cultivation under changing climate conditions and developing more resilient varieties .

How can structure-function relationships of ndhE be investigated experimentally?

Investigating structure-function relationships of ndhE requires a multi-faceted experimental approach:

  • Mutagenesis strategies:

    • Site-directed mutagenesis targeting conserved residues within the protein

    • Creation of truncated variants (similar to DHN1a_s and DHN1a_u variants in Vitis vinifera dehydrins)

    • Expression of both wild-type and modified proteins in heterologous systems

  • Functional comparison assays:

    • Electron transport activity measurements comparing modified versions

    • Interaction studies with other components of the NAD(P)H dehydrogenase complex

    • Stress protection assays under varied environmental conditions

  • Structural analysis methods:

    • Circular dichroism spectroscopy to determine secondary structure elements

    • Limited proteolysis to identify domain boundaries and flexible regions

    • Computational modeling validated by experimental constraints

  • Data analysis approach:

    • Correlation of functional changes with specific structural modifications

    • Statistical analysis of replicate measurements for significance testing

    • Integration with phylogenetic analysis to identify evolutionarily conserved features

This integrated approach can reveal which structural elements are essential for different aspects of ndhE function, similar to how Φ- and K-segments have been shown to be crucial for dehydrin functionality in Vitis vinifera .

What methods can determine the interaction between ndhE and other components of the photosynthetic apparatus?

To investigate interactions between ndhE and other photosynthetic components, researchers can employ several complementary approaches:

  • Co-purification methods:

    • Affinity-tagged ndhE pulldown followed by mass spectrometry

    • Blue-native PAGE to preserve native complex interactions

    • Crosslinking studies to capture transient interactions

  • Biophysical interaction characterization:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • In vivo validation approaches:

    • Split fluorescent protein complementation assays

    • Förster resonance energy transfer (FRET) between labeled components

    • Genetic complementation in model organisms

  • Data interpretation framework:

    • Integration of multiple interaction detection methods

    • Correlation with functional assays under various conditions

    • Comparison with published interaction data from related species

This multi-method approach provides robust evidence of physiologically relevant interactions, similar to how researchers have investigated DNA interactions of Vitis vinifera dehydrin splice variants, revealing that both spliced variants interact weakly with DNA, suggesting K-segments are not involved in DNA binding .

How should experimental design be optimized for studying ndhE expression under different environmental conditions?

Optimization of experimental design for studying ndhE expression under varying environmental conditions should follow established methodological frameworks:

  • Design of Experiments (DOE) approach:

    • Implement D-optimal experimental design using statistical software (e.g., Modde v12.1)

    • Define key sources of variation (plant material type, environmental parameters)

    • Include at least 18 different experimental conditions plus replicates

  • Key variables to control:

    • Type of plant material (X1): Different tissues or cultivars of Vitis vinifera

    • Environmental parameter ranges (X2, X3): Temperature (typically 4-40°C), water availability, light intensity

    • Duration of exposure to conditions: Both short-term and long-term effects should be assessed

  • Response variables measurement:

    • Transcript levels (RT-qPCR)

    • Protein abundance (Western blotting)

    • Functional activity (electron transport assays)

  • Statistical analysis framework:

    • ANOVA to determine significant factors

    • Response surface methodology to model relationships

    • Principal component analysis for data with multiple response variables

This approach has been successfully applied to other Vitis vinifera research, such as polyphenolic extraction optimization, and provides a systematic framework that maximizes information while minimizing experimental runs .

What analytical methods are most appropriate for studying ndhE protein structure?

For comprehensive structural analysis of ndhE protein, researchers should consider the following analytical methods:

This multi-technique approach acknowledges the challenges of membrane protein structural biology while providing complementary data that can be integrated to build a comprehensive structural model of ndhE.

How can nanopublication frameworks improve the reproducibility of ndhE research?

Nanopublication frameworks offer significant advantages for improving reproducibility in ndhE research:

  • Structured knowledge representation:

    • Format research claims as subject-predicate-object assertions

    • Include detailed provenance information about experimental methods

    • Provide machine-readable metadata about publication context

  • Implementation procedure:

    • Create standardized templates for common ndhE experiment types

    • Encode experimental parameters, conditions, and results in RDF format

    • Link assertions to supporting evidence and methodological details

  • Contradiction detection capabilities:

    • Automatically identify potentially conflicting research claims

    • Calculate precision and recall metrics to evaluate contradiction significance

    • Group characteristics by type (categorical vs. numerical) for analysis

  • Practical benefits for researchers:

    • Simplified literature comparison across multiple studies

    • Reduced likelihood of overlooking contradictory findings

    • Enhanced ability to identify methodological differences explaining varied results

    • Facilitated meta-analysis without manual data extraction

These frameworks have demonstrated effectiveness in detecting contradictions in research literature with an F-score of 0.56, offering a promising approach to improve research synthesis and reproducibility in ndhE studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.