Recombinant Vitis vinifera Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

CP47 serves dual roles in PSII:

  • Light harvesting: Transfers energy from peripheral light-harvesting complexes to the PSII reaction center .

  • Structural stability: Stabilizes the manganese cluster in the OEC, essential for water splitting .

  • Pathogen response: Downregulation of CP47 in susceptible grapevines correlates with PSII photoinhibition during Plasmopara viticola infection, reducing photosynthetic efficiency .

Recombinant Production

The recombinant protein is typically expressed in E. coli systems for research applications:

Key Findings:

  • Pathogen Interactions: In resistant grapevines (Vitis spp.), CP47 stability under pathogen stress preserves PSII efficiency, unlike susceptible varieties where its degradation exacerbates photoinhibition .

  • Mutagenesis Studies: Substitutions in the 384R–385R domain disrupt OEC assembly, highlighting its role in manganese cluster stabilization .

  • Assembly Factors: Pam68 protein binds ribosomes during CP47 synthesis, ensuring proper chlorophyll integration .

Table 3: Pathogen-Induced Changes in CP47 Expression

Grapevine GenotypePathogenCP47 AbundancePSII Efficiency
Resistant (LB)Plasmopara viticolaStableMaintained
Susceptible (PN)Plasmopara viticolaReducedDecreased

Applications in Biotechnology

  • Antibody Development: Anti-CP47 antibodies (e.g., PhytoAB PHY0058A) enable PSII profiling in crop plants .

  • Stress Tolerance Engineering: Overexpression of CP47 in transgenic lines could enhance resilience to biotic/abiotic stressors .

  • Structural Biology: Used in cryo-EM studies to resolve PSII architecture at near-atomic resolution .

Future Directions

  • Chlorophyll Loading Mechanisms: Elucidate how Pam68 mediates chlorophyll insertion during CP47 synthesis .

  • CRISPR-Based Modifications: Target psbB to improve photosynthetic efficiency in grapevines under climate stress.

  • Cross-Species Compatibility: Test CP47 hybrids (e.g., Vitis-Spinacia) for enhanced light-harvesting traits .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47 (Photosystem II chlorophyll apoprotein, encoded by the psbB gene) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the initial light-driven photochemical reactions of PSII. PSII functions as a light-powered water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from water, generating oxygen and a proton gradient that drives ATP synthesis.
Database Links

KEGG: vvi:4025125

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CP47 (psbB) in Photosystem II?

CP47, encoded by the psbB gene, is a critical component of the core complex of Photosystem II (PSII). Its primary functions include:

  • Binding chlorophyll molecules to help catalyze the primary light-induced photochemical processes of PSII

  • Serving as an internal antenna that transfers excitation energy from the peripheral antenna to the reaction center

  • Supporting the structural integrity of the PSII complex

The CP47 protein contains specific histidine residues arranged in pairs that are spaced by 13 or 14 amino acids and located in hydrophobic regions of the protein. These histidine residues are believed to play a critical role in chlorophyll binding within the protein structure .

How conserved is the psbB gene across different plant species?

The psbB gene demonstrates significant conservation across photosynthetic organisms, though with notable species variations:

  • The DNA sequence of psbB in cyanobacterium Synechocystis 6803 shows approximately 68% homology with that of spinach

  • The predicted amino acid sequence demonstrates higher conservation at 76% homology between these species

  • Despite sequence differences, the hydropathy patterns of Synechocystis and spinach CP-47 are almost indistinguishable, indicating the same general CP-47 folding pattern in the thylakoid membrane across different species

This conservation pattern suggests strong evolutionary pressure to maintain the structural and functional properties of CP47 across diverse photosynthetic organisms, despite variations in the nucleotide sequence.

What are the key structural features of the CP47 protein?

The CP47 protein possesses several distinctive structural features that contribute to its function:

  • Contains several transmembrane domains that anchor it within the thylakoid membrane

  • Features five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions, likely involved in chlorophyll binding

  • Exhibits remarkably similar hydropathy patterns across different species, indicating conserved protein folding and membrane integration despite sequence differences

  • Full-length protein typically consists of 508 amino acids, as observed in the Draba nemorosa CP47 sequence

The amino acid sequence for CP47 includes characteristic regions rich in hydrophobic residues that facilitate its integration into the thylakoid membrane while properly orienting the chlorophyll-binding domains.

What are the most effective methods for isolating recombinant psbB protein from expression systems?

Isolating recombinant CP47 protein requires specialized techniques due to its membrane-associated nature:

  • Expression System Selection:

    • E. coli is commonly used for recombinant CP47 expression, as demonstrated with the Draba nemorosa Photosystem II CP47 chlorophyll apoprotein

    • Expression constructs typically include a His-tag fusion to facilitate purification

  • Protein Extraction Protocol:

    • Cell disruption via sonication or French press in buffer containing mild detergents

    • Membrane protein solubilization using detergents such as n-dodecyl β-D-maltoside (DDM) or Triton X-100

    • Centrifugation to separate solubilized proteins from insoluble debris

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography as an additional purification step

  • Storage Considerations:

    • Lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol and aliquoting for long-term storage at -20°C/-80°C

    • Avoiding repeated freeze-thaw cycles to maintain protein integrity

How can antibodies against CP47 be utilized in photosynthesis research?

Antibodies against the CP47 protein serve as valuable tools in photosynthesis research through multiple applications:

  • Experimental Applications:

    • Western blot analysis to detect and quantify CP47 protein levels

    • Immunoprecipitation to study protein-protein interactions within the PSII complex

    • Immunolocalization to visualize the distribution of CP47 in chloroplast preparations

    • Monitoring PSII assembly and turnover under various environmental conditions

  • Antibody Selection Considerations:

    • Commercial antibodies are available with cross-reactivity across multiple plant species

    • The PHY0058A antibody demonstrates broad cross-reactivity with CP47 from numerous plant species including Arabidopsis thaliana, Vitis vinifera, Spinacia oleracea, and Chlamydomonas reinhardtii

    • PHY0319 shows specificity to Arabidopsis thaliana

    • PHY3933A offers extensive cross-reactivity similar to PHY0058A but with additional reactivity to Physcomitrella patens

  • Experimental Design Recommendations:

    • Include appropriate positive and negative controls

    • Optimize antibody concentration for each application

    • Consider specific cross-reactivity profiles when working with different plant species

What methodologies are recommended for analyzing psbB gene expression in Vitis vinifera?

Analysis of psbB gene expression in Vitis vinifera requires specialized approaches due to its chloroplast genome location:

  • RNA Extraction Protocols:

    • Modified CTAB method with PVP addition to reduce polyphenol contamination

    • Commercial kits optimized for plant tissues rich in polyphenols and polysaccharides

    • Inclusion of β-mercaptoethanol to prevent RNA oxidation

  • Expression Analysis Techniques:

    • Quantitative RT-PCR using chloroplast gene-specific primers

    • RNA-Seq with specific mapping parameters for chloroplast transcripts

    • Northern blotting for direct visualization of transcript size and abundance

  • Genetic Variation Assessment:

    • DNA markers such as SSR, RAPD, and SNP can be used to characterize different Vitis vinifera cultivars

    • Next-generation sequencing approaches to identify polymorphisms

  • Data Normalization Considerations:

    • Use of appropriate reference genes for chloroplast transcripts

    • Consideration of cultivar-specific genetic variation

    • Normalization to nuclear-encoded photosynthetic genes for comparative studies

How does the structure-function relationship of CP47 vary across Vitis vinifera cultivars?

The structure-function relationship of CP47 across Vitis vinifera cultivars remains an area requiring further investigation, but existing research suggests:

  • Cultivar Genetic Diversity:

    • Vitis vinifera cultivars show significant genetic diversity as revealed by molecular markers

    • Different biotypes within traditional cultivars demonstrate genetic variation that could potentially extend to chloroplast genes

  • Methodological Approaches:

    • Comparative sequence analysis of the psbB gene across cultivars

    • Protein structure prediction and molecular modeling to identify functional variations

    • Functional assays to measure PSII efficiency in different cultivars

  • Research Considerations:

    • While wild and cultivated Vitis vinifera populations show genetic differences , specific variations in chloroplast genes like psbB remain less characterized

    • Greek cultivars ('Xinomavro,' 'Agiorgitiko,' 'Mavrotragano') have been shown to differ genetically from other European strains , suggesting potential variations in chloroplast genes

What is the relationship between CP47 and D1 protein in PSII assembly and repair?

The relationship between CP47 and D1 protein represents a critical aspect of PSII assembly and repair:

  • Functional Interaction:

    • CP47 and D1 (encoded by psbA) work cooperatively within the PSII complex

    • D1 protein is highly dynamic under varying light conditions and requires efficient synthesis for PSII maintenance

    • CP47 is essential for a functional PSII complex, as demonstrated by the loss of PSII activity when the psbB gene is interrupted

  • Regulatory Mechanisms:

    • LOW PHOTOSYNTHETIC EFFICIENCY 1 (LPE1) facilitates D1 translation by binding to the 5' UTR of psbA mRNA in a light-dependent manner

    • LPE1 interacts with HIGH CHLOROPHYLL FLUORESCENCE 173 (HCF173) to regulate D1 synthesis

    • The synthesis and assembly of CP47 and D1 must be coordinated for proper PSII biogenesis

  • Research Implications:

    • Studies of CP47-D1 interactions could provide insights into PSII assembly mechanisms

    • Understanding this relationship is crucial for engineering photosynthetic efficiency

How can recombinant CP47 be used to study PSII-mediated ROS production?

Recombinant CP47 provides valuable opportunities for studying PSII-mediated reactive oxygen species (ROS) production:

  • Experimental Approaches:

    • Reconstitution of partial PSII complexes with recombinant CP47

    • Site-directed mutagenesis of histidine residues to alter chlorophyll binding

    • In vitro assays to measure ROS production under controlled conditions

  • Analytical Methods:

    • Fluorescent probes for ROS detection (e.g., DCFH-DA for H₂O₂)

    • Electron paramagnetic resonance (EPR) spectroscopy for superoxide detection

    • HPLC analysis of oxidative damage products

  • Application in Stress Research:

    • Investigation of how structural variations in CP47 affect ROS production

    • Correlation between CP47 modifications and photoprotection mechanisms

What strategies can overcome difficulties in expressing full-length CP47 protein?

Expressing full-length CP47 protein presents several challenges due to its hydrophobic nature and complex folding requirements:

  • Expression System Optimization:

    • Use of specialized E. coli strains designed for membrane protein expression

    • Consideration of cell-free expression systems for difficult proteins

    • Lower induction temperatures (16-20°C) to improve proper folding

  • Construct Design Considerations:

    • Codon optimization for the expression host

    • Strategic placement of affinity tags to minimize interference with protein folding

    • Fusion partners such as thioredoxin or SUMO to enhance solubility

  • Extraction and Purification Improvements:

    • Screening multiple detergents to identify optimal solubilization conditions

    • Inclusion of stabilizing agents such as glycerol or specific lipids

    • Gradient purification approaches to separate properly folded protein

  • Quality Control Measures:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate folding status

    • Functional assays to confirm biological activity

How can researchers address discrepancies in CP47 functional studies across different experimental systems?

Addressing discrepancies in CP47 functional studies requires systematic approaches:

  • Standardization Practices:

    • Detailed documentation of experimental conditions

    • Use of reference materials and standard operating procedures

    • Collaborative cross-laboratory validation studies

  • Methodological Considerations:

    • Careful selection of detergents that maintain protein structure

    • Consistent protein:lipid ratios in reconstitution experiments

    • Control for species-specific variations in CP47 sequence and function

  • Data Integration Approaches:

    • Meta-analysis of published results with attention to methodological differences

    • Development of mathematical models to normalize data across systems

    • Use of multiple complementary techniques to validate findings

What methodological considerations are important when comparing wild-type and recombinant CP47 protein characteristics?

Comparing wild-type and recombinant CP47 proteins requires attention to several methodological considerations:

  • Structural Equivalence Assessment:

    • Spectroscopic methods to compare protein folding and secondary structure

    • Analysis of chlorophyll binding capacity and specificity

    • Thermal stability comparisons

  • Functional Comparisons:

    • Energy transfer efficiency measurements

    • Integration into partial or complete PSII complexes

    • Response to photoinhibitory conditions

  • System-Specific Considerations:

    • Accounting for post-translational modifications present in wild-type but absent in recombinant protein

    • Lipid environment differences between natural thylakoid membranes and reconstitution systems

    • Potential impacts of affinity tags on protein function

  • Validation Approaches:

    • In vivo complementation assays using CP47-deficient mutants

    • Cross-linking studies to analyze protein-protein interactions

    • Combined structural and functional analyses

What emerging technologies might advance our understanding of CP47 structure-function relationships?

Several emerging technologies show promise for advancing CP47 research:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for high-resolution structure determination

    • Integrative structural biology combining multiple techniques (X-ray crystallography, NMR, mass spectrometry)

    • Time-resolved structural studies to capture dynamic changes during photosynthesis

  • Genetic Engineering Innovations:

    • CRISPR-Cas9 editing of the chloroplast genome to introduce precise modifications

    • Directed evolution approaches to identify functional variants

    • Synthetic biology redesign of CP47 for enhanced photosynthetic efficiency

  • Computational Methods:

    • Molecular dynamics simulations to study CP47 in membrane environments

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for energy transfer processes

    • Machine learning approaches to predict structure-function relationships

How might engineered variations in CP47 contribute to improving crop photosynthetic efficiency?

Engineered CP47 variants offer potential pathways to improved crop photosynthesis:

  • Targeted Modifications:

    • Engineering of chlorophyll-binding sites to optimize light harvesting

    • Modifications to enhance stability under heat or high light stress

    • Adjustments to energy transfer efficiency to reduce photoinhibition

  • Crop Improvement Strategies:

    • Chloroplast transformation with optimized psbB genes

    • Screening of natural genetic variation in psbB across Vitis vinifera cultivars for beneficial traits

    • Integration with other photosynthetic enhancement approaches

  • Performance Evaluation Methods:

    • Gas exchange measurements to assess photosynthetic efficiency

    • Chlorophyll fluorescence analysis of PSII function

    • Field trials under various environmental conditions

What are the implications of CP47 research for understanding evolutionary adaptations in photosynthesis?

CP47 research provides insights into photosynthetic evolution:

  • Evolutionary Analyses:

    • Comparative genomics of psbB across diverse photosynthetic organisms

    • Analysis of sequence conservation patterns to identify functionally critical regions

    • Reconstruction of ancestral sequences to understand evolutionary trajectories

  • Adaptation Studies:

    • Investigation of CP47 variations in plants adapted to different light environments

    • Analysis of how CP47 structure relates to photosynthetic efficiency in different habitats

    • Correlation between CP47 sequence variations and stress tolerance

  • Biodiversity Implications:

    • Understanding how CP47 variations contribute to photosynthetic diversity

    • Assessment of CP47 as a potential target for climate adaptation breeding

    • Conservation of genetic resources with valuable CP47 variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.